Txndc12 (thioredoxin domain containing 12)

Advanced Search (OLGA)

Gene: Txndc12 (thioredoxin domain containing 12) Rattus norvegicus

Analyze

Symbol:

Txndc12

Name:

thioredoxin domain containing 12

RGD ID:

1305960

Description:

Predicted to enable protein-disulfide reductase (glutathione) activity. Predicted to act upstream of or within negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway. Located in endoplasmic reticulum lumen. Orthologous to human TXNDC12 (thioredoxin domain containing 12); PARTICIPATES IN glutathione metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC298370; RGD1305960; similar to RIKEN cDNA 0610040B21; thioredoxin domain containing 12 (endoplasmic reticulum); thioredoxin domain-containing protein 12

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	128,815,471 - 128,841,574 (+)	NCBI		GRCr8
mRatBN7.2	5	123,587,854 - 123,612,886 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	123,586,781 - 123,612,870 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	126,210,642 - 126,235,652 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	127,933,744 - 127,958,758 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	127,985,034 - 128,010,042 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	128,450,830 - 128,475,858 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	128,450,680 - 128,475,864 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	132,291,196 - 132,316,224 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	130,142,600 - 130,167,629 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	130,147,623 - 130,172,855 (+)	NCBI
Celera	5	122,322,074 - 122,347,022 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

acrylamide (ISO)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

chlorpyrifos (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

gentamycin (EXP)

ivermectin (ISO)

microcystin-LR (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

Cellular Component

endoplasmic reticulum (IBA,ISO)

endoplasmic reticulum lumen (IDA,IEA,ISO)

Molecular Function

oxidoreductase activity (IEA)

protein binding (ISO)

protein-disulfide reductase (glutathione) activity (IEA,ISO,ISS)

protein-disulfide reductase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glutathione metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins.	Knoblach B, etal., Mol Cell Proteomics. 2003 Oct;2(10):1104-19. doi: 10.1074/mcp.M300053-MCP200. Epub 2003 Aug 19.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:18628206	PMID:35352799

Genomics

Comparative Map Data

Txndc12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	128,815,471 - 128,841,574 (+)	NCBI		GRCr8
mRatBN7.2	5	123,587,854 - 123,612,886 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	123,586,781 - 123,612,870 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	126,210,642 - 126,235,652 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	127,933,744 - 127,958,758 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	127,985,034 - 128,010,042 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	128,450,830 - 128,475,858 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	128,450,680 - 128,475,864 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	132,291,196 - 132,316,224 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	130,142,600 - 130,167,629 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	130,147,623 - 130,172,855 (+)	NCBI
Celera	5	122,322,074 - 122,347,022 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI

TXNDC12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	52,020,131 - 52,056,171 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	52,020,131 - 52,055,772 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	52,485,803 - 52,521,843 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	52,258,391 - 52,293,635 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	50,773,286 - 50,808,524 (-)	NCBI		Celera
Cytogenetic Map	1	p32.3	NCBI
HuRef	1	50,603,209 - 50,639,242 (-)	NCBI		HuRef
CHM1_1	1	52,603,297 - 52,639,345 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	51,901,645 - 51,937,676 (-)	NCBI		T2T-CHM13v2.0

Txndc12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	108,691,875 - 108,719,317 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	108,691,798 - 108,719,324 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	108,834,678 - 108,862,120 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	108,834,601 - 108,862,127 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	108,507,283 - 108,534,725 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	108,332,610 - 108,360,052 (+)	NCBI		MGSCv36	mm8
Celera	4	107,172,837 - 107,199,896 (+)	NCBI		Celera
Cytogenetic Map	4	C7	NCBI
cM Map	4	50.64	NCBI

Txndc12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	7,070,555 - 7,094,981 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955464	7,070,555 - 7,094,991 (+)	NCBI	ChiLan1.0	ChiLan1.0

TXNDC12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	174,803,916 - 174,840,151 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	173,946,705 - 173,981,702 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	51,271,206 - 51,307,248 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	52,875,130 - 52,911,051 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	52,875,130 - 52,911,051 (-)	Ensembl	panpan1.1		panPan2

TXNDC12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	9,261,493 - 9,292,097 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	9,262,004 - 9,291,553 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	9,414,248 - 9,444,245 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	9,386,745 - 9,416,751 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	9,386,741 - 9,503,119 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	9,197,412 - 9,227,390 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	9,286,920 - 9,316,775 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	9,304,316 - 9,334,308 (+)	NCBI		UU_Cfam_GSD_1.0

Txndc12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	66,514,852 - 66,607,833 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	8,877,826 - 8,903,110 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	8,877,832 - 8,900,659 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TXNDC12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	160,137,018 - 160,168,222 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	160,136,744 - 160,168,225 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	147,852,519 - 147,870,966 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TXNDC12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	80,894,151 - 80,929,686 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	80,895,228 - 80,929,704 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	36,341,887 - 36,377,088 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Txndc12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624859	1,137,563 - 1,162,766 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624859	1,137,428 - 1,160,502 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Txndc12
222 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	62
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000010700
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1582230	Bw78	Body weight QTL 78	3.2	0.0016	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	119085612	128034027	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
7794739	Bp372	Blood pressure QTL 372		0.0058	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	117913688	125222967	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

RH128568

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	123,612,458 - 123,612,670 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	128,475,434 - 128,475,645	NCBI	Rnor6.0
Rnor_5.0	5	132,315,800 - 132,316,011	UniSTS	Rnor5.0
RGSC_v3.4	5	130,167,205 - 130,167,416	UniSTS	RGSC3.4
Celera	5	122,346,598 - 122,346,809	UniSTS
RH 3.4 Map	5	810.6	UniSTS
Cytogenetic Map	5	q35	UniSTS

RH128551

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	123,602,135 - 123,602,334 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	128,481,733 - 128,481,931	NCBI	Rnor6.0
Rnor_6.0	5	128,465,112 - 128,465,310	NCBI	Rnor6.0
Rnor_5.0	5	132,320,711 - 132,320,909	UniSTS	Rnor5.0
Rnor_5.0	5	132,305,478 - 132,305,676	UniSTS	Rnor5.0
RGSC_v3.4	5	130,156,883 - 130,157,081	UniSTS	RGSC3.4
Celera	5	122,336,276 - 122,336,474	UniSTS
RH 3.4 Map	5	811.1	UniSTS
Cytogenetic Map	5	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC100255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV117277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010700 ⟹ ENSRNOP00000010700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	123,586,781 - 123,612,870 (+)	Ensembl
Rnor_6.0 Ensembl	5	128,450,680 - 128,475,864 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098723 ⟹ ENSRNOP00000080736

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	123,587,849 - 123,610,683 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100650 ⟹ ENSRNOP00000094562

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	123,587,908 - 123,612,870 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102984 ⟹ ENSRNOP00000094076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	123,587,849 - 123,611,822 (+)	Ensembl

RefSeq Acc Id:

NM_001100840 ⟹ NP_001094310

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,816,546 - 128,841,574 (+)	NCBI
mRatBN7.2	5	123,587,854 - 123,612,883 (+)	NCBI
Rnor_6.0	5	128,450,830 - 128,475,858 (+)	NCBI
Rnor_5.0	5	132,291,196 - 132,316,224 (+)	NCBI
RGSC_v3.4	5	130,142,600 - 130,167,629 (+)	RGD
Celera	5	122,322,074 - 122,347,022 (+)	RGD

Sequence:

show sequence

ACATCACTTCCTTCGGTGTTTGGAGAGGAAAAAAATCTGGGAATCCGAGGGGTTGGGCTGAGCG
GCGATAAGAGGGCACAGGGGAGCTTCTCCTGGAAATCCTGTGTTCCCGCAATCCGGTGGCTCTG
TGCAACTACCCCAGTGGAGATGTCGCTTCGTTTCGGGGCCACCTGTTTGCTGAGCTTCAGTTTC
CTGCTCCTCATCACTTCTTCAGACGGACGCACTGGGCTTGGAAAGGGTTTTGGAGATCATATTC
ACTGGAGGACTCTAGAAGATGGGAAGAAAGAAGCAGCTGCAAGTGGCTTGCCGCTGATGGTGAT
CATCCACAAGTCTTGGTGTGGAGCCTGCAAAGCTTTAAAACCCAAATTTGCAGAATCTACAGAA
ATTTCAGAACTGTCCCATAATTTCGTTATGGTAAATCTGGAGGATGAAGAGGAACCCAGGGATG
AAGACTTCAGTCCTGATGGGGGTTATATTCCGCGCATCCTTTTCTTGGATCCCAGTGGCAAGGT
GCGCCCTGAAATCATCAATGAGAGTGGAAACCCCAGCTACAAGTATTTCTACGTCAGTGCTGAG
CAAGTTGTTCAAGGGATGAAGGAAGCACAGGTGAGGCTGACTGGTGATGCCTTCAGAGAGAAAC
ATTTTCAGGATGAATTGTGATACGAATGAGTATTCTGAAAGAAAAGCTGCAGGGAGAGAATACG
GAAGAATCACCCAGAATAATTAAACCACCGGAAACCATGCTTCTACCTACACCGGAAGGAGCTC
TTACTGGGACAGGCCTGCTGACAGAAGCTGGTCTGTGCACCCAGCATCCTGGCCGACTGACTCT
CATCTGCTCCCTCTCCTAAATATCCATTCCTCTGAATGTAAAGAATGAAACTATTTAATACGAA
ACTTGAGCCACTTGGAGATTTGCTCCACGTCAGTATTTGAATCTTCATCCATTTCCTCCCACTT
CCTCAAGCTGAAGTGAAACAAACCGAAGTATCTTTTGTATAGTGTACAAAGTGCGGGAGGTCCT
TATCAGATTTTAAAGAAGGCTTGGTACTACTCCTGGACTTCCTGAATCCCTGCACCCTTCCTTC
TTTGCTCAGGCATCCCTGTTTGCACGGATGTGCGTCAAGAATGGCTGTGTGCTGAGGCTCAGCC
CCAACTGGAAGCATGTTTTCCCTGTTGTTAGAGAAACTCAAGCCTGCAAACCCTACATGAAGCC
ATTTTGTCAATTCACCAACTGTATTTTTGTACTGGGGTTAAAACAAACACAAGAGATAAAATAT
GTTTCACTAAGCTTTATTAAAACTTGAAATGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063287392 ⟹ XP_063143462

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,816,622 - 128,841,574 (+)	NCBI

RefSeq Acc Id:

XM_063287393 ⟹ XP_063143463

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	128,815,471 - 128,841,574 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001094310	(Get FASTA)	NCBI Sequence Viewer
	XP_063143462	(Get FASTA)	NCBI Sequence Viewer
	XP_063143463	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00256	(Get FASTA)	NCBI Sequence Viewer
	AAI58738	(Get FASTA)	NCBI Sequence Viewer
	EDL90384	(Get FASTA)	NCBI Sequence Viewer
	EDL90385	(Get FASTA)	NCBI Sequence Viewer
	EDL90386	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010700.5
	ENSRNOP00000080736.1
	ENSRNOP00000094076.1
	ENSRNOP00000094562.1
GenBank Protein	Q498E0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001094310 ⟸ NM_001100840
- Peptide Label:	precursor
- UniProtKB:	Q498E0 (UniProtKB/Swiss-Prot), A6JYW6 (UniProtKB/TrEMBL), B0BN97 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLRFGATCLLSFSFLLLITSSDGRTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWC GACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIIN ESGNPSYKYFYVSAEQVVQGMKEAQVRLTGDAFREKHFQDEL hide sequence

Ensembl Acc Id:

ENSRNOP00000010700 ⟸ ENSRNOT00000010700

Ensembl Acc Id:

ENSRNOP00000094562 ⟸ ENSRNOT00000100650

Ensembl Acc Id:

ENSRNOP00000080736 ⟸ ENSRNOT00000098723

Ensembl Acc Id:

ENSRNOP00000094076 ⟸ ENSRNOT00000102984

RefSeq Acc Id:	XP_063143463 ⟸ XM_063287393
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q4K2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063143462 ⟸ XM_063287392
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZQ94 (UniProtKB/TrEMBL)

Protein Domains

Thioredoxin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q498E0-F1-model_v2	AlphaFold	Q498E0	1-170	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693905

Promoter ID:

EPDNEW_R4429

Type:

initiation region

Name:

Txndc12_1

Description:

thioredoxin domain containing 12

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	128,450,889 - 128,450,949	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305960	AgrOrtholog
BioCyc Gene	G2FUF-40372	BioCyc
Ensembl Genes	ENSRNOG00000008090	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010700.7	UniProtKB/TrEMBL
	ENSRNOT00000098723.1	UniProtKB/TrEMBL
	ENSRNOT00000100650.1	UniProtKB/Swiss-Prot
	ENSRNOT00000102984.1	UniProtKB/TrEMBL
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7458709	IMAGE-MGC_LOAD
	IMAGE:9098882	IMAGE-MGC_LOAD
InterPro	AGR/TXD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERp19	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:298370	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:116226	IMAGE-MGC_LOAD
	MGC:187905	IMAGE-MGC_LOAD
NCBI Gene	298370	ENTREZGENE
PANTHER	ANTERIOR GRADIENT PROTEIN-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	THIOREDOXIN DOMAIN-CONTAINING PROTEIN 12	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Thioredoxin_7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Txndc12	PhenoGen
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
	THIOREDOXIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	THIOREDOXIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008090	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZQ94	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GKK4_RAT	UniProtKB/TrEMBL
	A0A8L2Q4K2	ENTREZGENE, UniProtKB/TrEMBL
	A6JYW6	ENTREZGENE, UniProtKB/TrEMBL
	A6JYW9_RAT	UniProtKB/TrEMBL
	B0BN97	ENTREZGENE, UniProtKB/TrEMBL
	Q498E0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Txndc12	thioredoxin domain containing 12	Txndc12	thioredoxin domain containing 12 (endoplasmic reticulum)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Txndc12	thioredoxin domain containing 12 (endoplasmic reticulum)	RGD1305960	similar to RIKEN cDNA 0610040B21	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1305960	similar to RIKEN cDNA 0610040B21	RGD1305960_predicted	similar to RIKEN cDNA 0610040B21 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305960_predicted	similar to RIKEN cDNA 0610040B21 (predicted)	LOC298370_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC298370_predicted	similar to RIKEN cDNA 0610040B21 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)