Tomm22 (translocase of outer mitochondrial membrane 22)

Advanced Search (OLGA)

Gene: Tomm22 (translocase of outer mitochondrial membrane 22) Rattus norvegicus

Analyze

Symbol:

Tomm22

Name:

translocase of outer mitochondrial membrane 22

RGD ID:

1303260

Description:

Enables protein transmembrane transporter activity. Involved in positive regulation of apoptotic process; protein insertion into mitochondrial membrane; and protein targeting to mitochondrion. Part of mitochondrial outer membrane translocase complex. Orthologous to human TOMM22 (translocase of outer mitochondrial membrane 22); PARTICIPATES IN beta-barrel pathway of mitochondrial protein import; carrier pathway of mitochondrial protein import; presequence pathway of mitochondrial protein import; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

mitochondrial import receptor subunit TOM22 homolog; rTOM22; TOM22; translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22 homolog; translocase of outer mitochondrial membrane 22 homolog (yeast)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	113,103,863 - 113,109,056 (+)	NCBI		GRCr8
mRatBN7.2	7	111,223,508 - 111,228,671 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	111,216,571 - 111,246,799 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,974,658 - 112,976,408 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	115,198,199 - 115,199,949 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	115,167,574 - 115,169,324 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,901,934 - 120,903,684 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,901,934 - 120,903,684 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	120,888,909 - 120,894,057 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,913,211 - 117,914,961 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,947,453 - 117,948,603 (+)	NCBI
Celera	7	107,557,387 - 107,559,137 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

myoclonic dystonia 26 (ISO)

neurodegeneration with brain iron accumulation 2A (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

aconitine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

chlorpyrifos (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

coumarin (ISO)

DDE (ISO)

deoxynivalenol (ISO)

dibutyl phthalate (ISO)

enniatin (ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

FR900359 (ISO)

furan (EXP)

ivermectin (ISO)

menadione (ISO)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

sodium arsenite (ISO)

Soman (EXP)

thiram (ISO)

trichloroethene (EXP)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular protein transport (IEA)

positive regulation of apoptotic process (IMP)

protein insertion into mitochondrial membrane (IMP)

protein insertion into mitochondrial outer membrane (IEA,ISO)

protein targeting to mitochondrion (IMP)

protein transmembrane transport (IEA)

Cellular Component

membrane (ISO)

mitochondrial outer membrane (IEA)

mitochondrial outer membrane translocase complex (IDA,IEA,ISO)

mitochondrion (ISO)

Molecular Function

mitochondrion targeting sequence binding (IEA,ISO)

protein binding (IPI,ISO)

protein transmembrane transporter activity (IMP)

Molecular Pathway Annotations Click to see Annotation Detail View

beta-barrel pathway of mitochondrial protein import (ISO)

carrier pathway of mitochondrial protein import (ISO)

presequence pathway of mitochondrial protein import (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Mitochondrial targeting of cytochrome P450 proteins containing NH2-terminal chimeric signals involves an unusual TOM20/TOM22 bypass mechanism.	Anandatheerthavarada HK, etal., J Biol Chem. 2009 Jun 19;284(25):17352-63. doi: 10.1074/jbc.M109.007492. Epub 2009 Apr 28.
2.	Bax inserts into the mitochondrial outer membrane by different mechanisms.	Cartron PF, etal., FEBS Lett. 2008 Sep 3;582(20):3045-51. doi: 10.1016/j.febslet.2008.07.047. Epub 2008 Aug 5.
3.	Unfolding-resistant translocase targeting: a novel mechanism for outer mitochondrial membrane localization exemplified by the Bbeta2 regulatory subunit of protein phosphatase 2A.	Dagda RK, etal., J Biol Chem. 2005 Jul 22;280(29):27375-82. Epub 2005 May 27.
4.	Biogenesis of mitochondrial outer membrane proteins, problems and diseases.	Ellenrieder L, etal., Biol Chem. 2015 Oct 1;396(11):1199-213. doi: 10.1515/hsz-2015-0170.
5.	Assembly of beta-barrel proteins in the mitochondrial outer membrane.	Hohr AI, etal., Biochim Biophys Acta. 2015 Jan;1853(1):74-88. doi: 10.1016/j.bbamcr.2014.10.006. Epub 2014 Oct 8.
6.	Targeting and assembly of rat mitochondrial translocase of outer membrane 22 (TOM22) into the TOM complex.	Nakamura Y, etal., J Biol Chem 2004 May 14;279(20):21223-32. Epub 2004 Feb 25.
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Unlocking the presequence import pathway.	Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
10.	Characterization of rat TOM70 as a receptor of the preprotein translocase of the mitochondrial outer membrane.	Suzuki H, etal., J Cell Sci 2002 May 1;115(Pt 9):1895-905.
11.	Cooperation of protein machineries in mitochondrial protein sorting.	Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.

Additional References at PubMed

PMID:12198123	PMID:12477932	PMID:12865426	PMID:15644312	PMID:18614015	PMID:19946888	PMID:33526603

Genomics

Comparative Map Data

Tomm22
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	113,103,863 - 113,109,056 (+)	NCBI		GRCr8
mRatBN7.2	7	111,223,508 - 111,228,671 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	111,216,571 - 111,246,799 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,974,658 - 112,976,408 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	115,198,199 - 115,199,949 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	115,167,574 - 115,169,324 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,901,934 - 120,903,684 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,901,934 - 120,903,684 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	120,888,909 - 120,894,057 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,913,211 - 117,914,961 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,947,453 - 117,948,603 (+)	NCBI
Celera	7	107,557,387 - 107,559,137 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

TOMM22
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	38,681,957 - 38,685,421 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	38,681,957 - 38,685,421 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	39,077,962 - 39,081,426 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	37,407,900 - 37,410,711 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	37,402,453 - 37,405,263	NCBI
Celera	22	22,884,631 - 22,887,442 (+)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	22,044,164 - 22,046,979 (+)	NCBI		HuRef
CHM1_1	22	39,036,846 - 39,039,661 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	39,152,160 - 39,155,628 (+)	NCBI		T2T-CHM13v2.0

Tomm22
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	79,555,069 - 79,557,063 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	79,555,062 - 79,557,601 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	79,670,868 - 79,672,862 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	79,670,861 - 79,673,400 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	79,501,298 - 79,503,292 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	79,498,123 - 79,500,117 (+)	NCBI		MGSCv36	mm8
Celera	15	81,796,265 - 81,798,069 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.85	NCBI

Tomm22
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	24,799,735 - 24,801,820 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	24,799,735 - 24,801,820 (+)	NCBI	ChiLan1.0	ChiLan1.0

TOMM22
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	48,537,569 - 48,540,122 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	51,228,944 - 51,231,496 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	19,596,941 - 19,599,499 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	37,414,704 - 37,417,229 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	37,414,704 - 37,417,229 (+)	Ensembl	panpan1.1		panPan2

TOMM22
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	26,116,635 - 26,118,692 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	26,072,167 - 26,074,221 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	26,907,763 - 26,909,817 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	26,907,769 - 26,909,795 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	26,629,429 - 26,631,481 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	26,940,542 - 26,942,596 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	27,117,431 - 27,119,486 (-)	NCBI		UU_Cfam_GSD_1.0

Tomm22
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	9,660,052 - 9,662,052 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	2,671,076 - 2,672,446 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	2,670,734 - 2,672,463 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TOMM22
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	9,336,130 - 9,350,015 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	9,336,114 - 9,339,867 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	6,579,626 - 6,581,626 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TOMM22
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	21,344,846 - 21,347,709 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	21,344,865 - 21,347,264 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	104,411,154 - 104,414,022 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tomm22
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	9,464,412 - 9,466,874 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	9,464,412 - 9,466,896 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tomm22
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	64
Interacting mature miRNAs:	78
Transcripts:	ENSRNOT00000019323
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

RH141915

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,226,069 - 111,226,265 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,901,083 - 120,901,278	NCBI	Rnor6.0
Rnor_5.0	7	120,891,456 - 120,891,651	UniSTS	Rnor5.0
RGSC_v3.4	7	117,912,360 - 117,912,555	UniSTS	RGSC3.4
Celera	7	107,556,536 - 107,556,731	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH127815

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,228,238 - 111,228,456 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,903,252 - 120,903,469	NCBI	Rnor6.0
Rnor_5.0	7	120,893,625 - 120,893,842	UniSTS	Rnor5.0
RGSC_v3.4	7	117,914,529 - 117,914,746	UniSTS	RGSC3.4
Celera	7	107,558,705 - 107,558,922	UniSTS
RH 3.4 Map	7	848.8	UniSTS
Cytogenetic Map	7	q34	UniSTS

AW529762

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,228,210 - 111,228,381 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,903,224 - 120,903,394	NCBI	Rnor6.0
Rnor_5.0	7	120,893,597 - 120,893,767	UniSTS	Rnor5.0
RGSC_v3.4	7	117,914,501 - 117,914,671	UniSTS	RGSC3.4
Celera	7	107,558,677 - 107,558,847	UniSTS
Cytogenetic Map	7	q34	UniSTS

BI281592

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	111,228,439 - 111,228,593 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,903,453 - 120,903,606	NCBI	Rnor6.0
Rnor_5.0	7	120,893,826 - 120,893,979	UniSTS	Rnor5.0
RGSC_v3.4	7	117,914,730 - 117,914,883	UniSTS	RGSC3.4
Celera	7	107,558,906 - 107,559,059	UniSTS
RH 3.4 Map	7	855.4	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_212514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB162854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019323 ⟹ ENSRNOP00000019323

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	111,216,571 - 111,228,654 (+)	Ensembl
Rnor_6.0 Ensembl	7	120,901,934 - 120,903,684 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095761 ⟹ ENSRNOP00000080542

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	111,226,923 - 111,246,799 (+)	Ensembl

RefSeq Acc Id:

NM_212514 ⟹ NP_997679

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	113,107,306 - 113,109,056 (+)	NCBI
mRatBN7.2	7	111,226,921 - 111,228,671 (+)	NCBI
Rnor_6.0	7	120,901,934 - 120,903,684 (+)	NCBI
Rnor_5.0	7	120,888,909 - 120,894,057 (+)	NCBI
RGSC_v3.4	7	117,913,211 - 117,914,961 (+)	RGD
Celera	7	107,557,387 - 107,559,137 (+)	RGD

Sequence:

show sequence

GTGTCCTACAGCCATGGCCGCCGCCGTCGCTGCAGCCGGCGCTGGGGAGCCTCTGTCCCCCGAA
GAATTGGTCCCGAAAGCCGAGGCAGAGAAAGCTGAGGAGGACCTGGAAGAAGACGACGACGACG
AGCTAGATGAGACCCTATCGGAGAGACTCTGGGGTCTGACGGAGATGTTTCCCGAGAGGGTCCG
GTCAGCCGCTGGAGCCACCTTTGATCTCTCGCTCTTCGTGGCTCAGAAGATGTACAGATTTTCC
AGGGCAGCTTTGTGGATTGGGACCACTTCCTTCATGATCCTGGTTCTTCCTGTTGTCTTTGAGA
CAGAAAAGTTGCAAATGGAGCAACAACAGCAACTGCAGCAAAGGCAGATACTTTTAGGGCCTAA
CACAGGACTGTCAGGAGGAATGCCAGGGGCTCTACCTCCACTTCCTGGAAAGATCTAGATTCTT
ATTTCGGTATTTGTCCGTGTGGGAGAACTTTGAAATTCATTTGTGTTTGAACTGCTGATTGTTT
GAACTTTTTATTCTTTTTTTTAACCTTGGCACATGGATCTCTTTGAACATAGTGGGAACTTTCT
CCGTTTCTCGTGGAGGGACCCCAGGTAAACCTGTGCCCTTCATAATGAATGCCCTCATTTACTT
CCTGTTCTCACTCCGATGCTGGAGTACAGCCATTTGGAAGGTTATCCCACTCTCCTTTAATAAA
TTGCTCCTAAGAAGTTCTTACATGCCCATAGTGGGAAAGAAGTTAAGTACCCCTGACTATAAGG
ACTTTTTTTTTAATGGAAATGTCTAGGACGTGTTAAACAGTGTGGGACTGACAAAATCCATTAC
ACCTGTAGTACAGCAGCCACCAGGGATCCGGTGTGTGCCAGGGAAAAGGGTGGCTGGCTGTAGC
TTTGGCCAGGGGGAGACTGGGCAGAGCAGACACTCATTTCCTCTGCACATTTCGGCTCTTAGAC
CTTCATGTGTATACAAAAGAAGTCAGCGCTCACTTTTTGTATTTAAATATTAAAAGAACTTGAA
CCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078838 ⟹ XP_038934766

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	113,103,863 - 113,109,056 (+)	NCBI
mRatBN7.2	7	111,223,508 - 111,228,671 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_997679	(Get FASTA)	NCBI Sequence Viewer
	XP_038934766	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98639	(Get FASTA)	NCBI Sequence Viewer
	BAD11364	(Get FASTA)	NCBI Sequence Viewer
	EDM15790	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019323.4
	ENSRNOP00000080542.1
GenBank Protein	Q75Q41	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_997679 ⟸ NM_212514
- UniProtKB:	Q75Q41 (UniProtKB/Swiss-Prot), A0A8I5ZQA0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAAVAAAGAGEPLSPEELVPKAEAEKAEEDLEEDDDDELDETLSERLWGLTEMFPERVRSAAG ATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLS GGMPGALPPLPGKI hide sequence

Ensembl Acc Id:

ENSRNOP00000019323 ⟸ ENSRNOT00000019323

RefSeq Acc Id:	XP_038934766 ⟸ XM_039078838
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q9P3 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000080542 ⟸ ENSRNOT00000095761

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q75Q41-F1-model_v2	AlphaFold	Q75Q41	1-142	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695484

Promoter ID:

EPDNEW_R6009

Type:

multiple initiation site

Name:

Tomm22_1

Description:

translocase of outer mitochondrial membrane 22

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	120,901,936 - 120,901,996	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303260	AgrOrtholog
BioCyc Gene	G2FUF-32753	BioCyc
Ensembl Genes	ENSRNOG00000014058	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019323.6	UniProtKB/TrEMBL
	ENSRNOT00000095761.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7324771	IMAGE-MGC_LOAD
InterPro	Tom22	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:300075	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112569	IMAGE-MGC_LOAD
NCBI Gene	300075	ENTREZGENE
PANTHER	MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM22 HOMOLOG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12504	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Tom22	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tomm22	PhenoGen
RatGTEx	ENSRNOG00000014058	RatGTEx
UniProt	A0A8I5ZQA0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q9P3	ENTREZGENE, UniProtKB/TrEMBL
	Q75Q41	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Tomm22	translocase of outer mitochondrial membrane 22	Tomm22	translocase of outer mitochondrial membrane 22 homolog (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Tomm22	translocase of outer mitochondrial membrane 22 homolog (yeast)	TOM22	TOM22 protein	Symbol and Name updated	1299863	APPROVED
2005-07-14	TOM22	TOM22 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	interacts with import receptor Tom20	1303976

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations