Nudt2 (nudix hydrolase 2) - Rat Genome Database

Name: Nudt2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Nudt2 (nudix hydrolase 2) Rattus norvegicus

Analyze

Symbol:

Nudt2

Name:

nudix hydrolase 2

RGD ID:

1303023

Description:

Predicted to enable bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity. Predicted to be involved in AMP biosynthetic process and ATP biosynthetic process. Orthologous to human NUDT2 (nudix hydrolase 2); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; aconitine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ap4A hydrolase; ap4Aase; bis(5'-nucleosyl)-tetraphosphatase; bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]; diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase; diadenosine tetraphosphatase; nucleoside diphosphate-linked moiety X motif 2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; nudix motif 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NUDT2 (nudix hydrolase 2)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nudt2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nudt2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NUDT2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NUDT2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nudt2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NUDT2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103219273 (bis(5'-nucleosyl)-tetraphosphatase [asymmetrical])	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nudt2 (nudix hydrolase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NUDT2 (nudix hydrolase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nudt2 (nudix hydrolase 2)	Alliance	DIOPT (OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	nudt2 (nudix (nucleoside diphosphate linked moiety X)-type motif 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ndx-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nudt2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	61,424,176 - 61,439,018 (+)	NCBI		GRCr8
mRatBN7.2	5	56,628,265 - 56,643,104 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	56,628,265 - 56,643,104 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	58,610,809 - 58,625,618 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	60,429,611 - 60,444,420 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	60,410,289 - 60,425,109 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	57,845,819 - 57,860,658 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	57,845,819 - 57,860,658 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	62,373,683 - 62,388,703 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	58,887,126 - 58,901,965 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	58,887,304 - 58,902,144 (+)	NCBI
Celera	5	55,224,185 - 55,239,014 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

Breast Neoplasms (ISO)

developmental and epileptic encephalopathy 11 (ISO)

distal arthrogryposis type 1A (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis 6 (ISO)

galactosemia (ISO)

INTELLECTUAL DEVELOPMENTAL DISORDER WITH OR WITHOUT PERIPHERAL NEUROPATHY (ISO)

intellectual disability (ISO)

paraplegia (ISO)

primary ciliary dyskinesia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (EXP)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diquat (ISO)

epoxiconazole (ISO)

fipronil (EXP)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

isobutanol (ISO)

methimazole (EXP)

monosodium L-glutamate (ISO)

oxaliplatin (EXP)

ozone (ISO)

P(1),P(4)-bis(5'-adenosyl) tetraphosphate (ISO)

p-toluidine (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

topotecan (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

AMP biosynthetic process (IBA)

ATP biosynthetic process (IBA)

Molecular Function

bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity (IBA,ISO,ISS)

GTP binding (IEA)

hydrolase activity (TAS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

azathioprine pharmacodynamics pathway (ISO)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

purine metabolic pathway (IEA,ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

pyrimidine metabolic pathway (IEA)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The MutT proteins or "Nudix" hydrolases, a family of versatile, widely distributed, "housecleaning" enzymes.	Bessman MJ, etal., J Biol Chem 1996 Oct 11;271(41):25059-62.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18614015	PMID:18644867

Genomics

Comparative Map Data

Nudt2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	61,424,176 - 61,439,018 (+)	NCBI		GRCr8
mRatBN7.2	5	56,628,265 - 56,643,104 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	56,628,265 - 56,643,104 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	58,610,809 - 58,625,618 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	60,429,611 - 60,444,420 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	60,410,289 - 60,425,109 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	57,845,819 - 57,860,658 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	57,845,819 - 57,860,658 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	62,373,683 - 62,388,703 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	58,887,126 - 58,901,965 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	58,887,304 - 58,902,144 (+)	NCBI
Celera	5	55,224,185 - 55,239,014 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

NUDT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	34,329,569 - 34,343,699 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	34,329,506 - 34,343,713 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	34,329,567 - 34,343,697 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	34,319,504 - 34,333,696 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	34,319,503 - 34,333,696	NCBI
Celera	9	34,261,031 - 34,275,223 (+)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	34,284,744 - 34,298,958 (+)	NCBI		HuRef
CHM1_1	9	34,328,965 - 34,343,459 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	34,348,133 - 34,362,241 (+)	NCBI		T2T-CHM13v2.0

Nudt2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	41,465,085 - 41,480,926 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	41,465,151 - 41,480,926 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	41,465,081 - 41,480,926 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	41,465,151 - 41,480,926 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	41,412,181 - 41,427,959 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	41,653,819 - 41,669,597 (+)	NCBI		MGSCv36	mm8
Celera	4	41,126,503 - 41,142,238 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	21.65	NCBI

Nudt2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	1,759,900 - 1,774,539 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	1,760,046 - 1,774,539 (-)	NCBI	ChiLan1.0	ChiLan1.0

NUDT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	90,260,687 - 90,274,948 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	90,266,630 - 90,280,888 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	34,165,452 - 34,179,722 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	34,974,218 - 34,988,453 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	34,974,240 - 34,988,453 (+)	Ensembl	panpan1.1		panPan2

NUDT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	51,049,992 - 51,064,317 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	51,050,053 - 51,064,178 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	49,679,551 - 49,693,877 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	51,991,703 - 52,006,029 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	51,860,446 - 52,008,042 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	50,654,675 - 50,668,990 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	50,522,494 - 50,536,832 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	51,287,553 - 51,301,886 (+)	NCBI		UU_Cfam_GSD_1.0

Nudt2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	165,891,335 - 165,905,018 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	2,441,860 - 2,454,174 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	2,438,947 - 2,452,647 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUDT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	32,451,064 - 32,466,839 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	32,450,986 - 32,466,893 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	36,618,569 - 36,654,875 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103219273
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	46,260,652 - 46,274,678 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666226	9,862 - 23,828 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nudt2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	38,744,895 - 38,761,499 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624736	38,745,476 - 38,761,156 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nudt2
46 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	39
Count of miRNA genes:	32
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000017712
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat

Markers in Region

RH136690

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	56,642,903 - 56,643,064 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	57,860,458 - 57,860,618	NCBI	Rnor6.0
Rnor_5.0	5	62,388,503 - 62,389,006	UniSTS	Rnor5.0
Rnor_5.0	5	62,388,503 - 62,388,663	UniSTS	Rnor5.0
RGSC_v3.4	5	58,901,765 - 58,901,925	UniSTS	RGSC3.4
Celera	5	55,238,814 - 55,238,974	UniSTS
Cytogenetic Map	5	q22	UniSTS

BF284944

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	56,642,909 - 56,643,064 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	57,860,464 - 57,860,618	NCBI	Rnor6.0
Rnor_5.0	5	62,388,509 - 62,389,006	UniSTS	Rnor5.0
Rnor_5.0	5	62,388,509 - 62,388,663	UniSTS	Rnor5.0
RGSC_v3.4	5	58,901,771 - 58,901,925	UniSTS	RGSC3.4
Celera	5	55,238,820 - 55,238,974	UniSTS
RH 3.4 Map	5	273.2	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_207596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017712 ⟹ ENSRNOP00000017712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	56,628,265 - 56,643,104 (+)	Ensembl
Rnor_6.0 Ensembl	5	57,845,819 - 57,860,658 (+)	Ensembl

RefSeq Acc Id:

NM_207596 ⟹ NP_997479

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	61,424,176 - 61,439,015 (+)	NCBI
mRatBN7.2	5	56,628,265 - 56,643,104 (+)	NCBI
Rnor_6.0	5	57,845,819 - 57,860,658 (+)	NCBI
Rnor_5.0	5	62,373,683 - 62,388,703 (+)	NCBI
RGSC_v3.4	5	58,887,126 - 58,901,965 (+)	RGD
Celera	5	55,224,185 - 55,239,014 (+)	RGD

Sequence:

show sequence

GGGGGAGAACCGCCTCCTGCCTCCTGCCTTCGTGCTGCGGATAGATCATGGCCCTGAGGGCATG
TGGCTTGATCATCTTCCGAAGACACCTTATTCCCAAGGTGGACAACACAACAATTGAATTTCTG
CTGCTGCAGGCGTCGGATGGCATTCATCACTGGACTCCTCCCAAAGGCCATGTGGACCCCGGCG
AGAATGACTTAGAAACAGCCCTGAGAGAGACTCAGGAGGAAACAGGCATAGAAGCAAGCCAGCT
GATCGTCCTTGAGGGGTTCAGAAGGGAGCTCAATTATGTGGCGAGGAAGAAGCCTAAAACAGTC
ATTTACTGGCTAGCAGAAGTGAAAGACTATGATGTAGAGATCCGCCTCTCCCAGGAGCATCAAG
CCTACCGCTGGCTAGGGCTGGATGAGGCCTGCCAGTTGGCTCAGTTCGAGGAGATGAAGGCAAC
GCTCCAAGAAGGACACCAGTTTCTCTGCTCCACACCAGCCTGAGCTGACCAGAACAAATGCTTC
CATGGCATCCTTAAGGGTTTTTGAGATGAGCCTACCCTTTCCATCCAGGGAAGGATGCGCTGGC
CTTGGGCTTGCTACAGCCGAGAGCAGATAGGTTAGTGAAATTAAATAACTCCACACTCAGCCAG
GAAGCCCTGGATTCAATCCCTAGCATAGAAAATAATTACTTTAAAAAGAAGAGCAAGGGGGTTG
GGGATTTAGCTCAGCGGTAGAGCACTTGCCTAGCAAGCGCAAGGCCCTGGGTTCGGTCCCCAGC
TCCGAAAAAAAGAAAAGGAGAAAAAAAAAAAGAACAAGGAAGATGGATTTTAGCAAAGGAGGGG
TACAGTCCTTAAAATGCCAGCCCTAAAGTACCTCTTTATCATTTATAAATAAACTTCAAGCAAC
TTACATGCCCTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063287302 ⟹ XP_063143372

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	61,434,852 - 61,439,018 (+)	NCBI

RefSeq Acc Id:

XM_063287303 ⟹ XP_063143373

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	61,427,356 - 61,439,018 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_997479	(Get FASTA)	NCBI Sequence Viewer
	XP_063143372	(Get FASTA)	NCBI Sequence Viewer
	XP_063143373	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58156	(Get FASTA)	NCBI Sequence Viewer
	EDL98670	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017712.3
	ENSRNOP00055022973
	ENSRNOP00060006162
	ENSRNOP00065004776
GenBank Protein	Q6PEC0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_997479 ⟸ NM_207596
- UniProtKB:	Q6PEC0 (UniProtKB/Swiss-Prot), A6IIV0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALRACGLIIFRRHLIPKVDNTTIEFLLLQASDGIHHWTPPKGHVDPGENDLETALRETQEETG IEASQLIVLEGFRRELNYVARKKPKTVIYWLAEVKDYDVEIRLSQEHQAYRWLGLDEACQLAQF EEMKATLQEGHQFLCSTPA hide sequence

Ensembl Acc Id:

ENSRNOP00000017712 ⟸ ENSRNOT00000017712

RefSeq Acc Id:	XP_063143373 ⟸ XM_063287303
- Peptide Label:	isoform X1
- UniProtKB:	Q6PEC0 (UniProtKB/Swiss-Prot), A6IIV0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063143372 ⟸ XM_063287302
- Peptide Label:	isoform X1
- UniProtKB:	Q6PEC0 (UniProtKB/Swiss-Prot), A6IIV0 (UniProtKB/TrEMBL)

Protein Domains

Nudix hydrolase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6PEC0-F1-model_v2	AlphaFold	Q6PEC0	1-147	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693650

Promoter ID:

EPDNEW_R4175

Type:

multiple initiation site

Name:

Nudt2_1

Description:

nudix hydrolase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	57,845,814 - 57,845,874	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303023	AgrOrtholog
BioCyc Gene	G2FUF-41560	BioCyc
Ensembl Genes	ENSRNOG00000013110	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055016807	UniProtKB/Swiss-Prot
	ENSRNOG00060004911	UniProtKB/Swiss-Prot
	ENSRNOG00065004807	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000017712.7	UniProtKB/Swiss-Prot
	ENSRNOT00055028534	UniProtKB/Swiss-Prot
	ENSRNOT00060008194	UniProtKB/Swiss-Prot
	ENSRNOT00065006963	UniProtKB/Swiss-Prot
Gene3D-CATH	Nucleoside Triphosphate Pyrophosphohydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6888562	IMAGE-MGC_LOAD
InterPro	Nudix_hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUDIX_hydrolase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUDIX_hydrolase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUDIX_hydrolase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nudix_hydrolase_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tetra_PHTase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:297998	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72999	IMAGE-MGC_LOAD
NCBI Gene	297998	ENTREZGENE
PANTHER	BIS(5'-NUCLEOSYL)-TETRAPHOSPHATASE [ASYMMETRICAL]	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DIADENOSINE 5,5-P1,P4-TETRAPHOSPHATE PYROPHOSPHOHYDROLASE MUTT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	NUDIX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nudt2	PhenoGen
PRINTS	NUDIXFAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TETRPHPHTASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	NUDIX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUDIX_BOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013110	RatGTEx
	ENSRNOG00055016807	RatGTEx
	ENSRNOG00060004911	RatGTEx
	ENSRNOG00065004807	RatGTEx
Superfamily-SCOP	Nudix	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6IIV0	ENTREZGENE, UniProtKB/TrEMBL
	AP4A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-10	Nudt2	nudix hydrolase 2	Nudt2	nudix (nucleoside diphosphate linked moiety X)-type motif 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Nudt2	nudix (nucleoside diphosphate linked moiety X)-type motif 2			Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Nudt2	nudix (nucleoside diphosphate linked moiety X)-type motif 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)