Has1 (hyaluronan synthase 1) - Rat Genome Database

Name: Has1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Has1 (hyaluronan synthase 1) Rattus norvegicus

Analyze

Symbol:

Has1

Name:

hyaluronan synthase 1

RGD ID:

708528

Description:

Predicted to enable hyaluronan synthase activity and identical protein binding activity. Involved in estrous cycle. Predicted to be located in Golgi apparatus and membrane. Predicted to be active in plasma membrane. Biomarker of pulmonary hypertension. Orthologous to human HAS1 (hyaluronan synthase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hyaluronan synthase1; LOC282821; similar to hyaluronan synthase1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HAS1 (hyaluronan synthase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	HAS1 (hyaluronan synthase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Has1 (hyaluronan synthase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	has1 (hyaluronan synthase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	has1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Allele / Splice:

Has1^m1Mcwi Has1^m2Mcwi Has1^m3Mcwi

Genetic Models:

FHH-Has1^m1Mcwi SS-Has1^m2Mcwi SS-Has1^m3Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	67,366,460 - 67,378,686 (-)	NCBI		GRCr8
mRatBN7.2	1	58,693,411 - 58,705,653 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	58,693,411 - 58,705,397 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	63,518,026 - 63,530,014 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	72,210,671 - 72,222,664 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	65,428,072 - 65,440,064 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	59,720,612 - 59,732,409 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	59,720,612 - 59,732,409 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	60,640,270 - 60,652,067 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	56,503,365 - 56,516,133 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	56,506,309 - 56,519,078 (-)	NCBI
Celera	1	54,874,356 - 54,879,329 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiomegaly (IEP)

genetic disease (ISO)

Kidney Reperfusion Injury (IEP)

myoepithelioma (ISO)

pulmonary hypertension (IEP)

tuberculosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,4-phenylenediamine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorogenic acid (ISO)

chlorpyrifos (ISO)

crocidolite asbestos (ISO)

dexamethasone (ISO)

dioxygen (EXP,ISO)

epoxiconazole (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glycidyl methacrylate (ISO)

graphite (EXP)

hyaluronic acid (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

indometacin (ISO)

lead(0) (ISO)

Licochalcone B (ISO)

malathion (ISO)

methylparaben (ISO)

ochratoxin A (EXP)

Osajin (ISO)

ozone (ISO)

paracetamol (EXP)

paraquat (EXP)

progesterone (ISO)

puerarin (ISO)

resveratrol (ISO)

Rosavin (ISO)

sodium arsenite (ISO)

Tesaglitazar (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triclosan (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to platelet-derived growth factor stimulus (ISO)

estrous cycle (IEP)

extracellular matrix assembly (IBA,ISO)

extracellular polysaccharide biosynthetic process (IBA,ISO)

hyaluronan biosynthetic process (IBA,ISO)

negative regulation of fibroblast migration (ISO)

Cellular Component

cytoplasm (ISO)

Golgi apparatus (ISO)

membrane (ISO)

plasma membrane (IBA,ISO)

Molecular Function

hyaluronan synthase activity (IBA,ISO)

identical protein binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Synthesis and fragmentation of hyaluronan in renal ischaemia.	Decleves AE, etal., Nephrol Dial Transplant. 2012 Oct;27(10):3771-81. doi: 10.1093/ndt/gfs098. Epub 2012 Apr 23.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Parallel up-regulation of FGF-2 and hyaluronan during development of cardiac hypertrophy in rat.	Hellman U, etal., Cell Tissue Res. 2008 Jan 15;.
4.	Mycobacteria exploit host hyaluronan for efficient extracellular replication.	Hirayama Y, etal., PLoS Pathog. 2009 Oct;5(10):e1000643. doi: 10.1371/journal.ppat.1000643. Epub 2009 Oct 30.
5.	Selective expression and functional characteristics of three mammalian hyaluronan synthases in oncogenic malignant transformation.	Itano N, etal., J Biol Chem 2004 Apr 30;279(18):18679-87. Epub 2004 Jan 14.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	The enzymatic degradation of hyaluronan is associated with disease progression in experimental pulmonary hypertension.	Ormiston ML, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Feb;298(2):L148-57. doi: 10.1152/ajplung.00097.2009. Epub 2009 Nov 13.
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Involvement of hyaluronan synthesis in ovarian follicle growth in rats.	Takahashi N, etal., Reproduction. 2013 Dec 19;147(2):189-97. doi: 10.1530/REP-13-0464. Print 2014 Feb.

Additional References at PubMed

PMID:10455188	PMID:10617644	PMID:17324121	PMID:19577615	PMID:24057227	PMID:25795779

Genomics

Comparative Map Data

Has1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	67,366,460 - 67,378,686 (-)	NCBI		GRCr8
mRatBN7.2	1	58,693,411 - 58,705,653 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	58,693,411 - 58,705,397 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	63,518,026 - 63,530,014 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	72,210,671 - 72,222,664 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	65,428,072 - 65,440,064 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	59,720,612 - 59,732,409 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	59,720,612 - 59,732,409 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	60,640,270 - 60,652,067 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	56,503,365 - 56,516,133 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	56,506,309 - 56,519,078 (-)	NCBI
Celera	1	54,874,356 - 54,879,329 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

HAS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	51,713,112 - 51,723,991 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	51,713,112 - 51,723,991 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	52,216,365 - 52,227,244 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	56,908,177 - 56,919,033 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	56,908,176 - 56,919,033	NCBI
Celera	19	49,265,901 - 49,276,762 (-)	NCBI		Celera
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	48,547,305 - 48,558,022 (-)	NCBI		HuRef
CHM1_1	19	52,218,163 - 52,229,047 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	54,800,274 - 54,811,173 (-)	NCBI		T2T-CHM13v2.0

Has1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	18,063,588 - 18,075,450 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	18,063,585 - 18,075,467 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	17,833,691 - 17,855,589 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	17,843,323 - 17,855,205 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	17,980,290 - 17,992,152 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	17,547,941 - 17,559,804 (-)	NCBI		MGSCv36	mm8
Celera	17	18,784,007 - 18,795,939 (-)	NCBI		Celera
Cytogenetic Map	17	A3.2	NCBI
cM Map	17	10.53	NCBI

Has1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955558	826,853 - 836,809 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955558	826,853 - 836,809 (+)	NCBI	ChiLan1.0	ChiLan1.0

HAS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	57,756,571 - 57,767,543 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	59,680,847 - 59,691,810 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	48,657,165 - 48,668,130 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	57,537,049 - 57,547,804 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	57,537,049 - 57,547,804 (-)	Ensembl	panpan1.1		panPan2

HAS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	105,376,091 - 105,386,043 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	105,376,536 - 105,385,134 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	104,949,702 - 104,959,564 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	105,886,101 - 105,895,963 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	105,885,956 - 105,895,628 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	105,558,334 - 105,568,196 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	105,199,396 - 105,209,300 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	105,994,224 - 106,004,086 (+)	NCBI		UU_Cfam_GSD_1.0

Has1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	4,768,242 - 4,775,106 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937026	125,881 - 135,235 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937026	125,622 - 132,141 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HAS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	58,302,799 - 58,313,486 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	58,303,274 - 58,313,486 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	51,877,028 - 51,888,298 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HAS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	44,540,036 - 44,552,396 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	44,540,363 - 44,547,711 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	24,594,280 - 24,606,885 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Has1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	3,329,920 - 3,336,290 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	3,327,626 - 3,341,928 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Has1
45 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	55
Interacting mature miRNAs:	58
Transcripts:	ENSRNOT00000014824
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat

Markers in Region

D1Got378

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	58,705,915 - 58,706,072 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	59,732,928 - 59,733,084	NCBI	Rnor6.0
Rnor_5.0	1	60,652,586 - 60,652,742	UniSTS	Rnor5.0
RGSC_v3.4	1	56,516,652 - 56,516,808	UniSTS	RGSC3.4
Cytogenetic Map	1	q12	UniSTS

Genetic Models

This gene Has1 is modified in the following models/strains:

FHH-Has1^m1Mcwi SS-Has1^m2Mcwi SS-Has1^m3Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	1	23	10	1	10	1	7	7	11	6	12	11	7
Below cutoff	2	18	23	16	9	16	1	4	23	9	18		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB097568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS279114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS389044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS409318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS410376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014824 ⟹ ENSRNOP00000014824

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	58,693,411 - 58,705,397 (-)	Ensembl
Rnor_6.0 Ensembl	1	59,720,612 - 59,732,409 (-)	Ensembl

RefSeq Acc Id:

NM_172323 ⟹ NP_758826

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	67,366,460 - 67,378,444 (-)	NCBI
mRatBN7.2	1	58,693,411 - 58,705,397 (-)	NCBI
Rnor_6.0	1	59,720,612 - 59,732,409 (-)	NCBI
Rnor_5.0	1	60,640,270 - 60,652,067 (-)	NCBI
RGSC_v3.4	1	56,503,365 - 56,516,133 (-)	RGD
Celera	1	54,874,356 - 54,879,329 (-)	NCBI

Sequence:

show sequence

AGAGCAAGTCGGAAAAGAGAAAATCCAGGAGGACCCACAGCCATGAGACAGGACATGCCAAAGC
CCTCAGAGGCAGCACGTTGCTGCTCCGGTCTGGCCAGGCGGGTGCTCACGATCACCTTCGCCCT
GCTCATCCTGGGCCTCATGACCTGGGCCTACGCAGCAGGAGTACCTCTGGCTTCTGATCCCTAT
GGCCTCCTGGCCTTTGGGCTCTATGGGGCGTTCCTCAGTGCGCACCTAGTGGCACAGAGCCTCT
TCGCTTACCTGGAGCACCGAAGGGTGACCGTGGCTGCGCGGCGCGCTTTTGCGAAGGGACCCCT
GGATGCGGCCACTGCGCGCAGCGTGGCACTCACCATCTCAGCCTACCAGGAGGACCCCACTTAC
CTGCGCCAGTGCTTGACCTCCGCGCGCGCCTTGCTGTACCCGCGCACGCGGCTGCGCGTGCTTA
TGGTTGTAGACGGCAATCGCGCGGAGGATCTGTACATGGTGGACATGTTCCGAGAAGTCTTCGC
AGATGAGGACCCTGCCACTTATGTGTGGGATGGCAACTACCATCAGCCTTGGGAGCCAGCTGAG
GCGGCGGGTGCTGTGGGTGAAGGTGCCTACCGCGAGGTGGAGGCTGAGGACCCTGGGCGGCTGG
CGGTAGAGGCGCTGGTGAGGACCCGCAGGTGCGTGTGCGTGGCTCAGCGCTGGGGTGGCAAGCG
CGAAGTCATGTACACGGCTTTCAAGGCACTGGGTGACTCCGTGGACTACGTGCAGGTCTGTGAC
TCAGACACAAGGTTAGACCCCATGGCACTGCTGGAGCTTGTGCGAGTGCTGGATGAAGACCCCC
GGGTAGGTGCTGTTGGAGGAGATGTGAGAATCCTTAACCCTCTGGACTCTTGGGTCAGCTTCTT
GAGCAGCCTTCGATACTGGGTAGCCTTCAATGTGGAGCGAGCTTGTCAGAGCTACTTTCACTGT
GTGTCCTGCATCAGTGGTCCTCTGGGTCTATACAGAAACAATCTCCTGCAGCAGTTCCTGGAGG
CCTGGTACAACCAGAAGTTCCTGGGCACCCACTGCACATTTGGGGATGACAGGCACCTCACCAA
CCGCATGCTTAGCATGGGCTACGCTACCAAGTATACCTCGCGCTCCAGATGCTATTCAGAGACG
CCCTCCTCTTTCCTTCGTTGGCTGAGCCAGCAGACCCGCTGGTCCAAATCTTATTTCCGAGAGT
GGCTATACAACGCCCTGTGGTGGCACCGCCACCACGCGTGGATGACCTATGAAGCGGTGGTTTC
TGGCCTCTTCCCTTTCTTTGTGGCTGCCACGGTGCTGAGGCTCTTCTATGCAGGGCGCCCATGG
GCTCTGCTCTGGGTGCTGCTCTGCGTGCAGGGCGTGGCACTGGCAAAGGCAGCCTTTGCAGCCT
GGCTGCGTGGCTGCCTGCGCATGGTGCTGCTGTCACTCTATGCACCACTCTACATGTGCGGCCT
GCTGCCTGCCAAGTTCCTGGCGTTGGTTACCATGAATCAAAGTGGTTGGGGCACCTCGGGCCGG
AAGAAACTGGCTGCTAACTATGTACCCGTGTTGCCCCTGGCACTCTGGGCTCTACTGCTGCTTG
GAGGCCTGATCCGCAGTGTGGCCCAGGAGGTCAGAGCTGACTGGAGTGGCCCATCACGAGCAGC
TGAAGCCTACCACCTTGCTGCTGGGGCCAGTGCCTATGTGGCCTACTGGGTGATAATGTTGACT
ATCTATTGGGTAGGTGTAAGGAGACTGTGCAGACGTCGGAGCGGTGGCTACCGTGTCCAAGTAT
GAGTCTGGGTATGAAGATGCCCCTGAGGGCTGTTAAAAGAGGCAAGAGGAGTCCTTATGAGGTA
GCCCTGGAGCCACGGATTTCATGGGGACTGAGTTTACCTTCTTTTTGAAAAGAGGAATCATACA
GATTCTTCACTATGGACTGTATTGGAATTCTGACTTCTCGGTCTCTGGGGAGGGGTAATTTATT
GATCAGGGAGTGGGATTATAGGACCAGGGTCAGAAGGCCTCTGCTTTCTCCCTGTTGCTATTTA
ATGTTTGTACTGTAAGATATAATAAAATTTTTTAATTTATTTTCTTC

hide sequence

RefSeq Acc Id:

XM_039102599 ⟹ XP_038958527

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	67,367,298 - 67,378,686 (-)	NCBI
mRatBN7.2	1	58,696,746 - 58,705,653 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_758826	(Get FASTA)	NCBI Sequence Viewer
	XP_038958527	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC43730	(Get FASTA)	NCBI Sequence Viewer
	CAJ87383	(Get FASTA)	NCBI Sequence Viewer
	CAL40924	(Get FASTA)	NCBI Sequence Viewer
	CAL44788	(Get FASTA)	NCBI Sequence Viewer
	CAL47705	(Get FASTA)	NCBI Sequence Viewer
	EDL99793	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014824
	ENSRNOP00000014824.4

RefSeq Acc Id:

NP_758826 ⟸ NM_172323

- UniProtKB:

Q8CH93 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRQDMPKPSEAARCCSGLARRVLTITFALLILGLMTWAYAAGVPLASDPYGLLAFGLYGAFLSA
HLVAQSLFAYLEHRRVTVAARRAFAKGPLDAATARSVALTISAYQEDPTYLRQCLTSARALLYP
RTRLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAEAAGAVGEGAYREVE
AEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDTRLDPMALLELV
RVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFHCVSCISGPLGLYRNN
LLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSRCYSETPSSFLRWLSQQTRW
SKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVLRLFYAGRPWALLWVLLCVQGVAL
AKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLALVTMNQSGWGTSGRKKLAANYVPVLPLA
LWALLLLGGLIRSVAQEVRADWSGPSRAAEAYHLAAGASAYVAYWVIMLTIYWVGVRRLCRRRS
GGYRVQV

hide sequence

RefSeq Acc Id:

ENSRNOP00000014824 ⟸ ENSRNOT00000014824

RefSeq Acc Id:	XP_038958527 ⟸ XM_039102599
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CH93-F1-model_v2	AlphaFold	Q8CH93	1-583	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689652

Promoter ID:

EPDNEW_R175

Type:

single initiation site

Name:

Has1_1

Description:

hyaluronan synthase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	59,732,426 - 59,732,486	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708528	AgrOrtholog
BioCyc Gene	G2FUF-61255	BioCyc
Ensembl Genes	ENSRNOG00000010994	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014824	ENTREZGENE
	ENSRNOT00000014824.5	UniProtKB/TrEMBL
InterPro	Nucleotide-diphossugar_trans	UniProtKB/TrEMBL
KEGG Report	rno:282821	UniProtKB/TrEMBL
NCBI Gene	282821	ENTREZGENE
PANTHER	HYALURONAN SYNTHASE	UniProtKB/TrEMBL
	PTHR22913:SF4	UniProtKB/TrEMBL
Pfam	Glyco_tranf_2_3	UniProtKB/TrEMBL
PhenoGen	Has1	PhenoGen
RatGTEx	ENSRNOG00000010994	RatGTEx
Superfamily-SCOP	SSF53448	UniProtKB/TrEMBL
UniProt	A6KB72_RAT	UniProtKB/TrEMBL
	Q8CH93	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Has1	hyaluronan synthase 1	LOC688205	similar to hyaluronan synthase1	Data merged from RGD:1591217	1643240	APPROVED
2006-11-20	LOC688205	similar to hyaluronan synthase1			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-07-08	Has1	hyaluronan synthase1	LOC282821		Symbol updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar