Ube2n (ubiquitin-conjugating enzyme E2N)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ube2n (ubiquitin-conjugating enzyme E2N) Rattus norvegicus

Analyze

Symbol:

Ube2n

Name:

ubiquitin-conjugating enzyme E2N

RGD ID:

621096

Description:

Enables ubiquitin-protein transferase activity. Predicted to be involved in several processes, including DNA repair; regulation of intracellular signal transduction; and regulation of protein ubiquitination. Predicted to act upstream of or within ubiquitin-dependent protein catabolic process. Predicted to be located in cytosol. Predicted to be part of UBC13-MMS2 complex; UBC13-UEV1A complex; and ubiquitin ligase complex. Predicted to be active in nucleus. Orthologous to human UBE2N (ubiquitin conjugating enzyme E2 N); PARTICIPATES IN altered ubiquitin/proteasome degradation pathway; Alzheimer's disease pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,4-dinitrotoluene; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

bendless protein; bendless-like ubiquitin-conjugating enzyme; E2 ubiquitin-conjugating enzyme N; MGC93937; ubiquitin carrier protein N; ubiquitin-conjugating enzyme E2 N; ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13); ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast); ubiquitin-protein ligase N

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UBE2N (ubiquitin conjugating enzyme E2 N)	RGD	RGD
Mus musculus (house mouse):	Ube2n (ubiquitin-conjugating enzyme E2N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ube2n (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UBE2N (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UBE2N (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ube2n (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UBE2N (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UBE2N (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ube2n (ubiquitin conjugating enzyme E2 N)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	UBE2NL (ubiquitin conjugating enzyme E2 N like (gene/pseudogene))	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	UBE2N (ubiquitin conjugating enzyme E2 N)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Ube2n (ubiquitin-conjugating enzyme E2N)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	ube2nb (ubiquitin-conjugating enzyme E2Nb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ube2na (ubiquitin-conjugating enzyme E2Na)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3473	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	UBC13	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubc-13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ben	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ube2n	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	30,154,330 - 30,184,373 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	30,154,616 - 30,184,355 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	32,140,834 - 32,170,868 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	34,314,601 - 34,344,553 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	34,089,552 - 34,119,441 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	36,610,147 - 36,640,190 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	36,610,147 - 36,640,189 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	36,673,991 - 36,674,365 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	32,719,959 - 32,750,002 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	32,740,229 - 32,770,272 (+)	NCBI
Celera	7	27,227,481 - 27,257,458 (+)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Embryo Loss (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

amiodarone (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butyric acid (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

choline (EXP)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dieldrin (EXP,ISO)

diethylstilbestrol (ISO)

diuron (ISO)

doxorubicin (ISO)

ethanol (EXP,ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (EXP,ISO)

fumonisin B1 (ISO)

geraniol (ISO)

glafenine (EXP)

gold atom (ISO)

gold(0) (ISO)

inulin (ISO)

isobutanol (ISO)

ivermectin (ISO)

L-ethionine (EXP)

L-methionine (EXP)

mercury atom (ISO)

mercury(0) (ISO)

methamphetamine (EXP)

methapyrilene (EXP)

methidathion (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

Monobutylphthalate (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrates (EXP)

omeprazole (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phlorizin (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

temozolomide (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (ISO)

biological_process (ND)

DNA double-strand break processing (ISO)

double-strand break repair via homologous recombination (ISO)

negative regulation of TORC1 signaling (ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of DNA repair (ISO)

positive regulation of double-strand break repair (ISO)

positive regulation of intracellular signal transduction (ISO)

positive regulation of protein K63-linked ubiquitination (ISO)

postreplication repair (IBA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO)

protein K63-linked ubiquitination (IBA,ISO,ISS)

protein ubiquitination (ISO,TAS)

regulation of histone ubiquitination (ISO)

T cell receptor signaling pathway (ISO)

ubiquitin-dependent protein catabolic process (ISO,TAS)

Cellular Component

cytoplasm (ISO)

cytosol (ISO)

nucleus (IBA,ISO)

protein-containing complex (ISO)

UBC13-MMS2 complex (ISO)

UBC13-UEV1A complex (ISO,ISS)

ubiquitin conjugating enzyme complex (ISO)

ubiquitin ligase complex (ISO,ISS)

Molecular Function

ATP binding (IEA)

protein binding (ISO)

ubiquitin binding (ISO)

ubiquitin conjugating enzyme activity (IBA,ISO,ISS)

ubiquitin protein ligase binding (ISO)

ubiquitin-protein transferase activator activity (ISO)

ubiquitin-protein transferase activity (IMP,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

altered ubiquitin/proteasome degradation pathway (IMP)

Alzheimer's disease pathway (IMP)

ataxia telangiectasia-mutated (ATM) signaling pathway (ISO)

interleukin-1 signaling pathway (ISO)

Toll-like receptor signaling pathway (ISO)

ubiquitin/proteasome degradation pathway (IEA,IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	ATM protein kinase: the linchpin of cellular defenses to stress.	Bhatti S, etal., Cell Mol Life Sci. 2011 Sep;68(18):2977-3006. doi: 10.1007/s00018-011-0683-9. Epub 2011 May 2.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Pathogen recognition by the innate immune system.	Kumar H, etal., Int Rev Immunol. 2011 Feb;30(1):16-34.
4.	Defective ubiquitination of cerebral proteins in Alzheimer's disease.	Lopez Salon M, etal., J Neurosci Res 2000 Oct 15;62(2):302-10.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Double-strand break repair: 53BP1 comes into focus.	Panier S and Boulton SJ, Nat Rev Mol Cell Biol. 2014 Jan;15(1):7-18. doi: 10.1038/nrm3719. Epub 2013 Dec 11.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	Control of ubiquitination of proteins in rat tissues by ubiquitin conjugating enzymes and isopeptidases.	Rajapurohitam V, etal., Am J Physiol Endocrinol Metab 2002 Apr;282(4):E739-45.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	TLR-4, IL-1R and TNF-R signaling to NF-kappaB: variations on a common theme.	Verstrepen L, etal., Cell Mol Life Sci. 2008 Oct;65(19):2964-78.
15.	Interleukin-1 (IL-1) pathway.	Weber A, etal., Sci Signal. 2010 Jan 19;3(105):cm1. doi: 10.1126/scisignal.3105cm1.

Additional References at PubMed

PMID:12039045	PMID:12477932	PMID:14406273	PMID:14695475	PMID:15125833	PMID:15383616	PMID:15489334	PMID:16122702	PMID:16129784	PMID:16307917	PMID:17349954	PMID:18410486
PMID:19340006	PMID:20061386	PMID:20458337	PMID:21512573	PMID:22424771	PMID:22681889	PMID:22797923	PMID:22871113	PMID:23376485	PMID:23533145	PMID:25936802	PMID:28039360
PMID:29097665	PMID:31006531

Genomics

Comparative Map Data

Ube2n
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	30,154,330 - 30,184,373 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	30,154,616 - 30,184,355 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	32,140,834 - 32,170,868 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	34,314,601 - 34,344,553 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	34,089,552 - 34,119,441 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	36,610,147 - 36,640,190 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	36,610,147 - 36,640,189 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	36,673,991 - 36,674,365 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	32,719,959 - 32,750,002 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	32,740,229 - 32,770,272 (+)	NCBI
Celera	7	27,227,481 - 27,257,458 (+)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

UBE2N
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	93,405,684 - 93,441,947 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	93,405,673 - 93,441,947 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	93,799,460 - 93,835,723 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	92,326,219 - 92,360,157 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	92,304,555 - 92,338,494	NCBI
Celera	12	93,472,777 - 93,506,718 (-)	NCBI		Celera
Cytogenetic Map	12	q22	NCBI
HuRef	12	90,868,751 - 90,902,701 (-)	NCBI		HuRef
CHM1_1	12	93,767,035 - 93,800,979 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	93,386,662 - 93,422,932 (-)	NCBI		T2T-CHM13v2.0

Ube2n
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	95,351,024 - 95,381,520 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	95,351,007 - 95,381,519 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	95,515,162 - 95,545,658 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	95,515,145 - 95,545,657 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	94,977,796 - 95,008,292 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	94,944,850 - 94,975,346 (+)	NCBI		MGSCv36	mm8
Celera	10	97,490,812 - 97,521,349 (+)	NCBI		Celera
Cytogenetic Map	10	C2	NCBI
cM Map	10	49.41	NCBI

Ube2n
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	30,240,408 - 30,278,360 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	30,240,402 - 30,278,362 (-)	NCBI	ChiLan1.0	ChiLan1.0

UBE2N
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	12	101,447,738 - 101,482,741 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	90,951,446 - 90,984,075 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	94,353,010 - 94,355,957 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

UBE2N
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	41,470,073 - 41,470,738 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	41,470,073 - 41,470,738 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	34,102,683 - 34,137,381 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	34,322,738 - 34,357,275 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	34,319,244 - 34,357,300 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	33,601,301 - 33,635,863 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	33,690,613 - 33,725,132 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	33,954,910 - 33,989,442 (-)	NCBI		UU_Cfam_GSD_1.0

Ube2n
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	26,350,027 - 26,359,632 (+)	NCBI		HiC_Itri_2

UBE2N
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	89,673,573 - 89,714,281 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	89,673,306 - 89,716,345 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	93,613,063 - 93,637,519 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UBE2N
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	88,810,505 - 88,842,895 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	156,319,857 - 156,353,219 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ube2n
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	13,432,661 - 13,457,776 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	13,432,657 - 13,468,797 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ube2n
176 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	668
Count of miRNA genes:	248
Interacting mature miRNAs:	302
Transcripts:	ENSRNOT00000074031, ENSRNOT00000074669, ENSRNOT00000075538
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
61369	Mcs2	Mammary carcinoma susceptibility QTL 2	3.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	19032807	35526300	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	19654317	49753746	Rat
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	19654317	49753746	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	29409683	53612950	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat

Markers in Region

RH142361

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	30,184,095 - 30,184,262 (-)	MAPPER	mRatBN7.2
mRatBN7.2	7	30,184,095 - 30,184,262 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	84,971,953 - 84,972,120 (-)	MAPPER	mRatBN7.2
mRatBN7.2	1	84,971,953 - 84,972,120 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	36,639,912 - 36,640,078	NCBI	Rnor6.0
Rnor_6.0	1	87,631,638 - 87,631,804	NCBI	Rnor6.0
Rnor_5.0	1	88,808,801 - 88,808,967	UniSTS	Rnor5.0
RGSC_v3.4	7	32,749,724 - 32,749,890	UniSTS	RGSC3.4
RGSC_v3.4	1	84,759,524 - 84,759,690	UniSTS	RGSC3.4
Celera	1	79,348,543 - 79,348,709	UniSTS
Cytogenetic Map	7	q13	UniSTS

RH125323

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	30,183,019 - 30,183,813 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	36,638,836 - 36,639,629	NCBI	Rnor6.0
Rnor_6.0	1	87,632,087 - 87,632,312	NCBI	Rnor6.0
Rnor_5.0	1	88,809,250 - 88,809,475	UniSTS	Rnor5.0
RGSC_v3.4	1	84,759,973 - 84,760,196	UniSTS	RGSC3.4
RGSC_v3.4	7	32,748,648 - 32,749,441	UniSTS	RGSC3.4
Celera	7	27,256,154 - 27,256,954	UniSTS
Celera	1	79,348,992 - 79,349,215	UniSTS
Cytogenetic Map	7	q13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB032739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC124896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC090072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000089874 ⟹ ENSRNOP00000071283

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	30,154,616 - 30,184,355 (+)	Ensembl
Rnor_6.0 Ensembl	7	36,610,147 - 36,640,189 (+)	Ensembl

RefSeq Acc Id:

NM_053928 ⟹ NP_446380

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	30,154,330 - 30,184,373 (+)	NCBI
Rnor_6.0	7	36,610,147 - 36,640,190 (+)	NCBI
Rnor_5.0	7	36,673,991 - 36,674,365 (+)	NCBI
RGSC_v3.4	7	32,719,959 - 32,750,002 (+)	RGD
Celera	7	27,227,481 - 27,257,458 (+)	RGD

Sequence:

show sequence

CTCTGGACGCCCAGTTGCGCGAATTCTGCCGCGGGCGAAGAAGCTCGGCGCCGCCTCGCGCCGC
CTCCCCCAAAGTCCCTGCCCCGCCGCGGAGCGTCACTTCCGCCACCCCGGGCTGGGGTTGGGGC
GGGGAGCGCGGGGGAGGGGGCCACTAGGTCGGAGGGAAGGCCGCCTGAAGCCCGCGCCCTAGCA
GGGACTACATTTCCCGAGGGGCCTCGGCGGAGGTAGCGACGGCGGGCGCGGCGACGTCCCCCGG
AAGTGGAGCCCGGGACTTCCACTCGTGCGTGAGGCGAGCGGAGCCGGAGACAAGAGCAGAGGCC
GAACTCGGGATCTGACAAGATGGCCGGGCTGCCCCGCAGGATCATCAAGGAAACCCAGCGTTTG
CTGGCAGAACCAGTTCCTGGCATTAAAGCAGAACCAGATGAGAGCAACGCCCGTTATTTTCATG
TGGTCATTGCTGGTCCCCAGGATTCCCCCTTTGAGGGAGGGACTTTTAAACTTGAACTATTCCT
TCCAGAAGAATACCCAATGGCAGCACCTAAAGTACGTTTCATGACCAAAATTTATCATCCTAAT
GTAGACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATAAGTGGTCCCCAGCACTGCAGA
TCCGAACAGTTCTGCTATCAATCCAGGCTTTGTTAAGTGCTCCTAATCCAGATGATCCATTAGC
AAATGATGTAGCTGAGCAGTGGAAGAGCAACGAAGCCCAAGCCATAGAAACAGCAAGAGCATGG
ACTAGGCTATATGCCATGAACAATATTTAAGTCGATCAGATCATCAAGTGTACACCACTTCTCC
TGTTCTGCCAAGACTTCTTCCTTTTTTTGTTTGCATTTAATGGACACAGTCTTAGAAACATTAC
AGAATAAAAGCCCAGGCATCTTCATCTTTGGTGATCACATGCACTTAGCAAACCTGTCTTGTCC
TGATTCACTGTTGTAAAGCATGAGCAGAGGCTAGAAGCATCACCCGGGTTGCTGAGAGATGCTG
AGAAGCAGGACTCTCTGCTTTGACTCCTTTCCCCATCATGGTCTAAGTACAAGGCACTGTGAAT
GAAGGTAGTTGTCAGGGTTAGCTGCCAGGGGCATGGGTGTTTTTATTTTATTTTTTAGGGGGAA
AGTAGTTTTATTTTAATTTTATGGCCTCCCCTCTCTTAAGGGATCTAATTGCAGTGGTTAAATG
CAGCTAACCGGTGTTTTAGAATATGCTCTCTAGCCAAGTCTAACTTTAGACGCTGTAGATGGAC
AAGCTTGACTGTCTGATCCAAAATGGGAACATTAAATAAACATCACAGCCCTCACTAATAACAT
TGTGACTTTGCCGTCAGGTGTAGATTCTCTGTCCCCCCCCCCCCCCCCCCAAAAGACGAAGAAA
AAGCTTGTGACCATTTTGTATGGCTTGTCTGGAAACTTCTGTAAATCTTATGTTTTAGTAAAAT
ATTTTTTGTTATTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446380	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH90072	(Get FASTA)	NCBI Sequence Viewer
	BAB20414	(Get FASTA)	NCBI Sequence Viewer
	EDM16856	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071283
GenBank Protein	Q9EQX9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446380 ⟸ NM_053928
- UniProtKB:	Q9EQX9 (UniProtKB/Swiss-Prot), A6IG42 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPM AAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQ WKSNEAQAIETARAWTRLYAMNNI hide sequence

RefSeq Acc Id:

ENSRNOP00000071283 ⟸ ENSRNOT00000089874

Protein Domains

UBC core

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EQX9-F1-model_v2	AlphaFold	Q9EQX9	1-152	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695159

Promoter ID:

EPDNEW_R5684

Type:

multiple initiation site

Name:

Ube2n_2

Description:

ubiquitin-conjugating enzyme E2N

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R5685

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	36,610,159 - 36,610,219	EPDNEW

RGD ID:

13695160

Promoter ID:

EPDNEW_R5685

Type:

initiation region

Name:

Ube2n_1

Description:

ubiquitin-conjugating enzyme E2N

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R5684

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	36,610,423 - 36,610,483	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621096	AgrOrtholog
BioCyc Gene	G2FUF-34333	BioCyc
BioCyc Pathway	PWY-7511 [protein ubiquitination]	BioCyc
Ensembl Genes	ENSRNOG00000058053	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000089874	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.110.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7113593	IMAGE-MGC_LOAD
InterPro	UBQ-conjugat_E2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBQ-conjugating_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBQ-conjugating_enzyme/RWD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:116725	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93937	IMAGE-MGC_LOAD
NCBI Gene	116725	ENTREZGENE
PANTHER	UBIQUITIN-CONJUGATING ENZYME	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBIQUITIN-CONJUGATING ENZYME E2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	UQ_con	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ube2n	PhenoGen
PROSITE	UBC_1	UniProtKB/TrEMBL
	UBC_2	UniProtKB/TrEMBL
	UBIQUITIN_CONJUGAT_1	UniProtKB/Swiss-Prot
	UBIQUITIN_CONJUGAT_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000058053	RatGTEx
SMART	UBCc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54495	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IG42	ENTREZGENE, UniProtKB/TrEMBL
	Q9EQX9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Ube2n	ubiquitin-conjugating enzyme E2N	Ube2n	ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-25	Ube2n	ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)	Ube2n	ubiquitin-conjugating enzyme E2N	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Ube2n	ubiquitin-conjugating enzyme E2N		ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)	Name updated	1299863	APPROVED
2002-08-07	Ube2n	ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	interacts with specific E3s; may mediate substrate selectivity	724779

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)