Dusp4 (dual specificity phosphatase 4)

Gene: Dusp4 (dual specificity phosphatase 4) Rattus norvegicus

Analyze

Symbol:

Dusp4

Name:

dual specificity phosphatase 4

RGD ID:

620625

Description:

Enables MAP kinase tyrosine/serine/threonine phosphatase activity and protein tyrosine/threonine phosphatase activity. Predicted to be involved in dephosphorylation; endoderm formation; and negative regulation of ERK1 and ERK2 cascade. Predicted to be located in nucleoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human DUSP4 (dual specificity phosphatase 4); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dual specificity protein phosphatase 4; MAP kinase phosphatase; MAP kinase phosphatase 2; mitogen-activated protein kinase phosphatase 2; Mkp-2; Mkp2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DUSP4 (dual specificity phosphatase 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Dusp4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dusp4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DUSP4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DUSP4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dusp4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DUSP4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DUSP4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dusp4 (dual specificity phosphatase 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Dusp4 (dual specificity phosphatase 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DUSP4 (dual specificity phosphatase 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dusp4 (dual specificity phosphatase 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MSG5	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dusp4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	64,079,893 - 64,101,396 (-)	NCBI		GRCr8
mRatBN7.2	16	57,376,659 - 57,398,161 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	57,377,229 - 57,398,138 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	62,711,691 - 62,721,924 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	66,125,603 - 66,135,836 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	61,345,654 - 61,355,885 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	61,080,767 - 61,090,973 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	61,078,175 - 61,091,169 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	60,749,903 - 60,769,025 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	61,109,626 - 61,119,981 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	61,109,700 - 61,120,056 (-)	NCBI
Celera	16	55,427,894 - 55,438,053 (-)	NCBI		Celera
Cytogenetic Map	16	q12.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

juvenile rheumatoid arthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

aripiprazole (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

avobenzone (ISO)

bathocuproine disulfonic acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bortezomib (ISO)

butanal (ISO)

cadmium atom (ISO)

cannabidiol (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cumene (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

cytarabine (ISO)

daidzein (ISO)

daunorubicin (ISO)

deguelin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

equol (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

febuxostat (ISO)

fenpyroximate (ISO)

ferric oxide (ISO)

fluoranthene (ISO)

folic acid (ISO)

fonofos (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glyphosate (ISO)

indole-3-methanol (EXP)

ionomycin (ISO)

isoflavones (ISO)

isoprenaline (ISO)

isotretinoin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

metacetamol (ISO)

metformin (EXP)

methapyrilene (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

mitomycin C (ISO)

mitoxantrone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-acetyl-L-cysteine (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

nickel sulfate (ISO)

niclosamide (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

parathion (ISO)

PD 0325901 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pyrrolidine dithiocarbamate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

Rebamipide (EXP)

rotenone (EXP)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sotorasib (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tebufenpyrad (ISO)

terbufos (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

thifluzamide (ISO)

thioacetamide (EXP)

toluene 2,4-diisocyanate (ISO)

trametinib (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (EXP,ISO)

vincristine (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoderm formation (IBA,IEA)

negative regulation of ERK1 and ERK2 cascade (ISO,ISS)

negative regulation of MAPK cascade (IBA,IEA)

protein dephosphorylation (IDA)

Cellular Component

cytoplasm (IBA,IEA)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

MAP kinase serine/threonine phosphatase activity (ISO,ISS)

MAP kinase tyrosine phosphatase activity (IBA,IEA)

MAP kinase tyrosine/serine/threonine phosphatase activity (IBA,IDA,IEA)

myosin phosphatase activity (IEA)

phosphatase activity (ISO)

protein binding (ISO)

protein tyrosine phosphatase activity (ISO,ISS)

protein tyrosine/threonine phosphatase activity (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Map kinase phosphatases (MKP's) are early responsive genes during induction of cerulein hyperstimulation pancreatitis.	Hofken T, etal., Biochem Biophys Res Commun. 2000 Sep 24;276(2):680-5.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	A novel mitogen-activated protein kinase phosphatase. Structure, expression, and regulation.	Misra-Press A, etal., J Biol Chem 1995 Jun 16;270(24):14587-96.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Inhibition of protein tyrosine/mitogen-activated protein kinase phosphatase activity is associated with D2 dopamine receptor supersensitivity in a rat model of Parkinson's disease.	Zhen X, etal., Mol Pharmacol 2002 Dec;62(6):1356-63.

Additional References at PubMed

PMID:7535768	PMID:12865160	PMID:16849326	PMID:24531476	PMID:24973647	PMID:32959171

Genomics

Comparative Map Data

Dusp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	64,079,893 - 64,101,396 (-)	NCBI		GRCr8
mRatBN7.2	16	57,376,659 - 57,398,161 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	57,377,229 - 57,398,138 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	62,711,691 - 62,721,924 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	66,125,603 - 66,135,836 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	61,345,654 - 61,355,885 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	61,080,767 - 61,090,973 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	61,078,175 - 61,091,169 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	60,749,903 - 60,769,025 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	61,109,626 - 61,119,981 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	61,109,700 - 61,120,056 (-)	NCBI
Celera	16	55,427,894 - 55,438,053 (-)	NCBI		Celera
Cytogenetic Map	16	q12.2	NCBI

DUSP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	29,333,064 - 29,350,684 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	29,333,064 - 29,350,684 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	29,190,581 - 29,208,201 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	29,249,530 - 29,264,104 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	29,249,538 - 29,262,241	NCBI
Celera	8	28,153,208 - 28,167,802 (-)	NCBI		Celera
Cytogenetic Map	8	p12	NCBI
HuRef	8	27,734,943 - 27,752,631 (-)	NCBI		HuRef
CHM1_1	8	29,392,567 - 29,410,254 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	29,611,341 - 29,628,961 (-)	NCBI		T2T-CHM13v2.0

Dusp4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	35,274,448 - 35,289,106 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	35,274,451 - 35,287,048 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	34,807,610 - 34,819,894 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	34,807,297 - 34,819,894 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	35,870,664 - 35,882,948 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	36,276,127 - 36,288,411 (+)	NCBI		MGSCv36	mm8
Celera	8	37,423,596 - 37,435,832 (+)	NCBI		Celera
Cytogenetic Map	8	A4	NCBI
cM Map	8	21.16	NCBI

Dusp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955463	5,778,700 - 5,794,282 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955463	5,778,945 - 5,794,282 (-)	NCBI	ChiLan1.0	ChiLan1.0

DUSP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	47,882,880 - 47,900,548 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	23,598,583 - 23,616,218 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	28,623,777 - 28,641,432 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	25,816,714 - 25,834,307 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	25,819,989 - 25,834,332 (-)	Ensembl	panpan1.1		panPan2

DUSP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ROS_Cfam_1.0	16	36,828,592 - 36,844,313 (+)	NCBI		ROS_Cfam_1.0

Dusp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	44,363,746 - 44,376,514 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936573	765,927 - 781,567 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936573	765,954 - 778,524 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DUSP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	55,491,087 - 55,508,455 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	55,491,084 - 55,508,460 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	62,906,062 - 62,923,413 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DUSP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	27,459,455 - 27,473,811 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	27,456,430 - 27,473,352 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	14,654,175 - 14,671,595 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dusp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624839	5,870,274 - 5,887,741 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dusp4
87 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	101
Count of miRNA genes:	82
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000016328
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	31951520	60148445	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		4	5		1				58	12	20	11
Low	3	39	36	25	18	25	8	11	16	23	21		8
Below cutoff			16	16		16

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY028781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U23438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016328 ⟹ ENSRNOP00000016328

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	57,377,229 - 57,398,138 (-)	Ensembl
Rnor_6.0 Ensembl	16	61,078,175 - 61,091,169 (-)	Ensembl

RefSeq Acc Id:

NM_022199 ⟹ NP_071535

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	64,079,893 - 64,093,700 (-)	NCBI
mRatBN7.2	16	57,376,659 - 57,390,467 (-)	NCBI
Rnor_6.0	16	61,080,767 - 61,090,973 (-)	NCBI
Rnor_5.0	16	60,749,903 - 60,769,025 (-)	NCBI
RGSC_v3.4	16	61,109,626 - 61,119,981 (-)	RGD
Celera	16	55,427,894 - 55,438,053 (-)	RGD

Sequence:

show sequence

ATGGTGACGATGGAGGAACTGCGGGAGATGGACTGCAGCGTGCTCAAAAGGCTGATGAACCGAG
ATGAGAACGGCGGCACGGCGGGCAGCAGCGGCGGCAGCCACGGCGCCCTGGGGCTGCTGAGCGG
CGGCAAGTGCTTGCTGCTGGACTGCAGGCCGTTTCTGGCTCACAGCGCGGGCTACATCCGAGGC
TCGGTGAACGTGCGCTGCAATACCATCGTGCGGCGGAGGGCCAAGGGCTCCGTGAGCCTGGAGC
AGATTCTGCCCGCCGAGGAAGAGGTGCGCGCCCGCCTGCGCTCTGGCCTCTACTCGGCTGTCAT
CGTCTACGATGAGCGCAGCCCGCGCGCCGAGAGTCTCCGGGAGGACAGCACAGTGTCGCTGGTC
GTGCAGGCGTTGCGCCGGAACGCGGAGCGCACAGACATCTGCCTGCTTAAAGGTGGCTATGAGA
GGTTTTCTTCTGAGTACCCAGAATTCTGCTCTAAAACTAAGGCCCTGGCCGCCATCCCACCCCC
CGTACCTCCCAGCACAAATGAGTCCTTGGATCTGGGCTGCAGCTCCTGTGGGACCCCACTGCAC
GACCAGGGGGGTCCTGTGGAGATCCTTCCTTTCCTCTACCTCGGCAGTGCCTACCACGCTGCCC
GCAGGGACATGCTTGATGCCCTGGGGATCACGGCTCTACTGAATGTCTCCTCAGACTGCCCCAA
TCACTTTGAGGGACATTACCAGTACAAGTGCATCCCGGTAGAAGATAACCACAAGGCTGACATC
AGCTCCTGGTTCATGGAAGCCATCGAATACATAGACGCAGTGAAGGACTGCCGAGGGCGAGTGC
TGGTTCACTGCCAGGCCGGCATCTCTAGATCAGCCACCATCTGCCTGGCCTACCTGATGATGAA
GAAACGGGTGAGGCTGGAGGAGGCTTTCGAGTTCGTCAAGCAGCGCCGTAGCATCATCTCGCCC
AACTTCAGCTTCATGGGCCAGTTGCTGCAGTTCGAGTCTCAGGTGCTCACCACGTCCTGCGCAG
CGGAGGCCGCCAGCCCTTCCGGGCCCCTGCGGGAGAGGGGGAAGGCCACTCCCACCCCCACCTC
GCAGTTCGTCTTCAGCTTCCCCGTGTCCGTGGGTGTGCACGCGGCTCCCAGTAACCTGCCGTAC
CTGCACAGCCCCATCACCACCTCCCCCAGCTGTTAG

hide sequence

RefSeq Acc Id:

XM_039094803 ⟹ XP_038950731

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	64,079,895 - 64,101,396 (-)	NCBI
mRatBN7.2	16	57,376,659 - 57,398,161 (-)	NCBI

RefSeq Acc Id:

XM_063275682 ⟹ XP_063131752

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	64,079,895 - 64,092,779 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_071535	(Get FASTA)	NCBI Sequence Viewer
	XP_038950731	(Get FASTA)	NCBI Sequence Viewer
	XP_063131752	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52493	(Get FASTA)	NCBI Sequence Viewer
	AAK31620	(Get FASTA)	NCBI Sequence Viewer
	EDM09188	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016328
	ENSRNOP00000016328.1
GenBank Protein	Q62767	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071535 ⟸ NM_022199

- UniProtKB:

Q62767 (UniProtKB/Swiss-Prot), G3V7L2 (UniProtKB/TrEMBL), A6IVN4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVTMEELREMDCSVLKRLMNRDENGGTAGSSGGSHGALGLLSGGKCLLLDCRPFLAHSAGYIRG
SVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLV
VQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSTNESLDLGCSSCGTPLH
DQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADI
SSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISP
NFSFMGQLLQFESQVLTTSCAAEAASPSGPLRERGKATPTPTSQFVFSFPVSVGVHAAPSNLPY
LHSPITTSPSC

hide sequence

RefSeq Acc Id:

ENSRNOP00000016328 ⟸ ENSRNOT00000016328

RefSeq Acc Id:	XP_038950731 ⟸ XM_039094803
- Peptide Label:	isoform X1
- UniProtKB:	Q62767 (UniProtKB/Swiss-Prot), G3V7L2 (UniProtKB/TrEMBL), A6IVN4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131752 ⟸ XM_063275682
- Peptide Label:	isoform X2

Protein Domains

Rhodanese Tyrosine specific protein phosphatases Tyrosine-protein phosphatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62767-F1-model_v2	AlphaFold	Q62767	1-395	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620625	AgrOrtholog
BioCyc Gene	G2FUF-11150	BioCyc
Ensembl Genes	ENSRNOG00000011921	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016328.4	UniProtKB/TrEMBL
Gene3D-CATH	3.40.250.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.90.190.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Dual-sp_phosphatase_cat-dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MKP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot-tyrosine_phosphatase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Rhodanese-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Rhodanese-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tyr_Pase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tyr_Pase_cat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TYR_PHOSPHATASE_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TYR_PHOSPHATASE_DUAL_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:60587	UniProtKB/Swiss-Prot
NCBI Gene	60587	ENTREZGENE
PANTHER	DUAL SPECIFICITY PROTEIN PHOSPHATASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DUAL SPECIFICITY PROTEIN PHOSPHATASE 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DSPc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Rhodanese	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dusp4	PhenoGen
PIRSF	MAPK_Ptase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	MAPKPHPHTASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RHODANESE_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TYR_PHOSPHATASE_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TYR_PHOSPHATASE_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TYR_PHOSPHATASE_DUAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011921	RatGTEx
SMART	DSPc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTPc_motif	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHOD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52799	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF52821	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IVN4	ENTREZGENE, UniProtKB/TrEMBL
	DUS4_RAT	UniProtKB/Swiss-Prot
	G3V7L2	ENTREZGENE, UniProtKB/TrEMBL
	Q62767	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-10	Dusp4	dual specificity phosphatase 4	Mkp-2	MAP kinase phosphatase	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-08-07	Mkp-2	MAP kinase phosphatase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)