Sag (S-antigen visual arrestin) - Rat Genome Database

Name: Sag
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Sag (S-antigen visual arrestin) Rattus norvegicus

Analyze

Symbol:

Sag

Name:

S-antigen visual arrestin

RGD ID:

3619

Description:

Enables spectrin binding activity. Predicted to be involved in G protein-coupled receptor internalization. Located in photoreceptor inner segment and photoreceptor outer segment. Human ortholog(s) of this gene implicated in Oguchi disease-1; hereditary night blindness; retinitis pigmentosa; and retinitis pigmentosa 47. Orthologous to human SAG (S-antigen visual arrestin); PARTICIPATES IN altered visual phototransduction pathway; retinitis pigmentosa pathway; visual phototransduction pathway; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

48 kDa protein; retina and pineal gland (arrestin); retinal S-antigen; rod photoreceptor arrestin; S-AG; S-antigen; S-antigen; retina and pineal gland (arrestin); S-arrestin; SAGMR; SANTI

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SAG (S-antigen visual arrestin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sag (S-antigen, retina and pineal gland (arrestin))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sag (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SAG (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SAG (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sag (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SAG (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SAG (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sag (S-antigen visual arrestin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Sag (S-antigen, retina and pineal gland (arrestin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SAG (S-antigen visual arrestin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	sagb (S-antigen; retina and pineal gland (arrestin) b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	saga (S-antigen; retina and pineal gland (arrestin) a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	arr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	krz	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	sag	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	95,915,640 - 95,956,641 (+)	NCBI		GRCr8
mRatBN7.2	9	88,467,797 - 88,508,821 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,469,376 - 88,508,820 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	96,893,929 - 96,933,394 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,030,109 - 102,069,572 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,397,588 - 100,437,033 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	94,926,901 - 94,972,162 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	94,928,489 - 94,972,027 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,646,333 - 94,691,522 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	86,759,933 - 86,799,902 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	86,944,774 - 86,983,310 (+)	NCBI
Celera	2	54,322,671 - 54,345,084 (-)	NCBI		Celera
Celera	9	85,877,786 - 85,890,904 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cone dystrophy (ISO)

congenital stationary night blindness (ISO)

fundus dystrophy (ISO)

genetic disease (ISO)

hereditary night blindness (ISO)

Joubert syndrome 22 (ISO)

Oguchi disease-1 (ISO)

Oguchi disease-2 (ISO)

Perlman syndrome (ISO)

retinitis pigmentosa (ISO)

retinitis pigmentosa 47 (ISO)

Retinitis Pigmentosa 96 (ISO)

uveitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

desferrioxamine B (EXP)

flavonoids (EXP)

furan (EXP)

methimazole (EXP)

PCB138 (EXP)

pirinixic acid (EXP)

propiconazole (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

G protein-coupled receptor internalization (IBA,IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

photoreceptor inner segment (IBA,IDA,IEA,ISO)

photoreceptor outer segment (IBA,IDA,IEA,ISO)

Molecular Function

G protein-coupled receptor binding (IBA,IEA)

opsin binding (IEA,ISO)

phosphoprotein binding (IEA,ISO)

protein binding (ISO)

spectrin binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

altered visual phototransduction pathway (ISO)

retinitis pigmentosa pathway (ISO)

visual phototransduction pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat pineal S-antigen: sequence analysis reveals presence of alpha-transducin homologous sequence.	Abe T, etal., FEBS Lett 1989 Apr 24;247(2):307-11.
2.	Photoreceptor signaling: supporting vision across a wide range of light intensities.	Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
3.	Differential expression of mRNA and protein encoding retinal and pineal S-antigen during the light/dark cycle.	Craft CM, etal., J Neurochem 1990 Nov;55(5):1461-73.
4.	Genes and mutations causing retinitis pigmentosa.	Daiger SP, etal., Clin Genet. 2013 Aug;84(2):132-41. doi: 10.1111/cge.12203. Epub 2013 Jun 19.
5.	A homozygous 1-base pair deletion in the arrestin gene is a frequent cause of Oguchi disease in Japanese.	Fuchs S, etal., Nat Genet 1995 Jul;10(3):360-2.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	The functional cycle of visual arrestins in photoreceptor cells.	Gurevich VV, etal., Prog Retin Eye Res. 2011 Nov;30(6):405-30. Epub 2011 Jul 29.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
12.	The giant spectrin betaV couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.	Papal S, etal., Hum Mol Genet. 2013 Sep 15;22(18):3773-88. doi: 10.1093/hmg/ddt228. Epub 2013 May 23.
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Comprehensive gene review and curation	RGD comprehensive gene curation
17.	Photoreceptor function of retinal transplants implicated by light-dark shift of S-antigen and rod transducin.	Seiler MJ, etal., Vision Res. 1999 Jul;39(15):2589-96.
18.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.	Photoreceptor degeneration: genetic and mechanistic dissection of a complex trait.	Wright AF, etal., Nat Rev Genet. 2010 Apr;11(4):273-84. doi: 10.1038/nrg2717.

Additional References at PubMed

PMID:2373176	PMID:3720866	PMID:12486395	PMID:19332500	PMID:22869374

Genomics

Comparative Map Data

Sag
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	95,915,640 - 95,956,641 (+)	NCBI		GRCr8
mRatBN7.2	9	88,467,797 - 88,508,821 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	88,469,376 - 88,508,820 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	96,893,929 - 96,933,394 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	102,030,109 - 102,069,572 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	100,397,588 - 100,437,033 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	94,926,901 - 94,972,162 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	94,928,489 - 94,972,027 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	94,646,333 - 94,691,522 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	86,759,933 - 86,799,902 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	86,944,774 - 86,983,310 (+)	NCBI
Celera	2	54,322,671 - 54,345,084 (-)	NCBI		Celera
Celera	9	85,877,786 - 85,890,904 (+)	NCBI		Celera
Cytogenetic Map	9	q35	NCBI

SAG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	233,307,816 - 233,347,055 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	233,307,816 - 233,347,055 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	234,216,462 - 234,255,701 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	233,881,207 - 233,920,440 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	233,998,492 - 234,037,701	NCBI
Celera	2	227,937,838 - 227,977,217 (+)	NCBI		Celera
Cytogenetic Map	2	q37.1	NCBI
HuRef	2	226,017,093 - 226,056,496 (+)	NCBI		HuRef
CHM1_1	2	234,222,389 - 234,261,775 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	233,795,900 - 233,835,144 (+)	NCBI		T2T-CHM13v2.0

Sag
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	87,731,402 - 87,772,880 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	87,731,402 - 87,772,880 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	87,798,143 - 87,845,158 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	87,803,680 - 87,845,158 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	89,700,255 - 89,741,732 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	89,634,851 - 89,676,328 (+)	NCBI		MGSCv36	mm8
Celera	1	90,761,584 - 90,803,003 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	44.44	NCBI

Sag
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	2,844,925 - 2,878,846 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	2,845,561 - 2,878,342 (-)	NCBI	ChiLan1.0	ChiLan1.0

SAG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	135,910,867 - 135,948,833 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	135,925,831 - 135,963,742 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	120,532,049 - 120,574,914 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	239,449,910 - 239,487,626 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	239,449,910 - 239,487,537 (+)	Ensembl	panpan1.1		panPan2

SAG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	44,800,141 - 44,843,580 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	44,812,362 - 44,843,579 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	45,307,685 - 45,338,815 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	45,060,350 - 45,103,430 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	45,072,284 - 45,103,429 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	44,996,643 - 45,027,722 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	44,842,616 - 44,873,724 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	44,997,874 - 45,029,086 (+)	NCBI		UU_Cfam_GSD_1.0

Sag
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	186,974,069 - 187,007,603 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936525	3,931,933 - 3,964,834 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936525	3,932,118 - 3,965,651 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SAG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	133,705,008 - 133,741,798 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	133,704,975 - 133,741,844 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	147,580,489 - 147,592,533 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Sscrofa10.2	15	147,812,862 - 147,835,188 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SAG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	119,343,562 - 119,383,119 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	119,344,090 - 119,382,983 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	80,120,831 - 80,162,410 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sag
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624843	5,844,823 - 5,870,300 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624843	5,837,105 - 5,870,417 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sag
168 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	23
Count of miRNA genes:	22
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000024733
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
4889943	Bss90	Bone structure and strength QTL 90	4.1		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	9	86369631	92058970	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	79271511	91616855	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	9	79271511	91616855	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	79271511	91616855	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat

Markers in Region

D9Rat6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	88,507,055 - 88,507,212 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	94,970,397 - 94,970,553	NCBI	Rnor6.0
Rnor_5.0	9	94,689,758 - 94,689,914	UniSTS	Rnor5.0
RGSC_v3.4	9	86,798,138 - 86,798,294	UniSTS	RGSC3.4
RGSC_v3.4	9	86,797,847 - 86,798,339	RGD	RGSC3.4
RGSC_v3.1	9	86,981,557 - 86,981,713	RGD
Celera	2	54,324,279 - 54,324,435	UniSTS
RH 3.4 Map	2	363.51	RGD
RH 3.4 Map	2	363.51	UniSTS
RH 2.0 Map	9	866.0	RGD
SHRSP x BN Map	9	56.8299	RGD
FHH x ACI Map	9	59.98	RGD
Cytogenetic Map	9	q35	UniSTS

D9Wox29

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	88,501,653 - 88,501,685 (+)	MAPPER	mRatBN7.2
mRatBN7.2	9	88,501,564 - 88,501,685 (+)	MAPPER	mRatBN7.2
mRatBN7.2	9	88,501,564 - 88,501,966 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	94,964,593 - 94,965,026	NCBI	Rnor6.0
Rnor_6.0	9	94,964,593 - 94,964,713	NCBI	Rnor6.0
Rnor_5.0	9	94,683,954 - 94,684,387	UniSTS	Rnor5.0
Rnor_5.0	9	94,683,954 - 94,684,074	UniSTS	Rnor5.0
RGSC_v3.4	9	86,792,647 - 86,792,767	UniSTS	RGSC3.4
Celera	2	54,329,806 - 54,329,914	UniSTS
Cytogenetic Map	9	q35	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	1		6	6	6	6					6
Below cutoff	1	31	18	14	9	14	2	2	26	19	19	11	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M60737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X15353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X51781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000024733 ⟹ ENSRNOP00000024733

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	88,469,376 - 88,508,820 (+)	Ensembl
Rnor_6.0 Ensembl	9	94,928,516 - 94,972,027 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085770 ⟹ ENSRNOP00000071579

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	88,469,376 - 88,508,686 (+)	Ensembl
Rnor_6.0 Ensembl	9	94,928,516 - 94,972,027 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000087366 ⟹ ENSRNOP00000072320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	94,928,489 - 94,969,040 (+)	Ensembl

RefSeq Acc Id:

NM_013023 ⟹ NP_037155

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	95,917,197 - 95,956,641 (+)	NCBI
mRatBN7.2	9	88,469,376 - 88,508,820 (+)	NCBI
Rnor_6.0	9	94,927,066 - 94,972,161 (+)	NCBI
Rnor_5.0	9	94,646,333 - 94,691,522 (+)	NCBI
RGSC_v3.4	9	86,759,933 - 86,799,902 (+)	RGD
Celera	2	54,322,671 - 54,345,084 (-)	NCBI
Celera	9	85,877,786 - 85,890,904 (+)	NCBI

Sequence:

show sequence

CAGCCAGGGCCTCACCCTTGCCCTGTGAGGTTATCTGATAGGATTTTACCAGTTCCCTCAGCGC
ACGGGGCTAGCTGCTCACCATCTGAAAGCACAGCCATTCGGCCTTGGACATACATCCCAAGGGA
CAGACAACATGGCAGCCTGTGTGAAGACCAATAAATCCCATGTCATCTTCAAGAAGGTCTCCCG
GGACAAGTCGGTGACCATCTACCTGGGGAAGAGAGACTATATAGATCACGTCAGCCAAGTAGAG
CCTGTAGATGGTGTTGTATTGGTGGATCCTGAGCTCGTGAAGGGGAAGAAAGTGTATGTCACCC
TGACCTGCGCCTTCCGCTATGGCCAAGAGGACATTGATGTGATTGGCCTGACCTTCCGCAGGGA
CCTGTATTTCTCTCGGGTCCAGGTATATCCTCCTGTTGGGGCCATGAGTGCCCCAACCCAGCTC
CAGTTGAGCCTGCTCAAGAAACTGGGAGATAACACGTACCCATTTCTGCTCACGTTCCCTGACT
ACCTACCCTGCTCAGTGATGTTGCAGCCAGCTCCACAAGATGTAGGGAAGAGCTGTGGGGTTGA
CTTTGAGGTTAAAGCATTTGCCACAGACATCACAGATGCTGAAGAGGACAAGATCCCCAAGAAG
AGCTCTGTGCGGTTACTGATCCGGAAGGTGCAGCATGCCCCACCTGAGATGGGTCCCCAGCCCT
GTGCTGAAGCCTCCTGGCAGTTCTTCATGTCTGACAAGCCCCTGCACCTCTCAGTCTCCCTCAG
CAAAGAGATATATTTCCATGGGGAGCCCATCCCTGTGACCGTGACTGTGACCAATAACACGGAG
AAGGTTGTGAAGAAGATTAAAGTGTCAGTGGAACAAATAGCCAATGTGGTTCTCTACTCGAGTG
ATTATTACGTCAAGCCTGTGGCCTCGGAGGAAACACAGGAAAAAGTGCAGCCAAACAGCACTTT
GACCAAGACGCTGGTGCTGGTGCCCCTCCTGGCTAACAACAGAGAAAGAAGAGGCATCGCGCTG
GATGGGAAGATCAAGCATGAGGACACAAACCTGGCCTCCAGCACCATTATCAAGGAGGGCATCG
ATCGGACCGTCATGGGCATCCTGGTGTCATACCATATCAAGGTGAAGCTCACGGTGTCAGGCTT
TCTAGGAGAGCTCACATCCAGTGAAGTGGCTACTGAGGTGCCGTTCCGTCTGATGCACCCCCAG
CCTGAGGACCCAGCAAAAGAAAGTGTCCAGGATGAAAATCTGGTTTTTGAAGAGTTTGCTCGAC
AAAATCTGAAAGATACTGGAGAGAATACAGAAGGGAAGAAAGATGAGGATGCAGGCCAGGATGA
GTGAAGACTTAGCCTTGATGCCTAGAAACTGCTTGTAGTCCTGGTTGCCTTGTGGGAAACCCCT
GGTAACCTTTCAGAGTTATGCTAAATACGAAAGCTCGAGCATTCTTCCCAGAAATAAAGTCTGT
GGGTCCTCCC

hide sequence

RefSeq Acc Id:

XM_039083069 ⟹ XP_038938997

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	95,915,640 - 95,956,507 (+)	NCBI
mRatBN7.2	9	88,467,797 - 88,508,821 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037155	(Get FASTA)	NCBI Sequence Viewer
	XP_038938997	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42107	(Get FASTA)	NCBI Sequence Viewer
	CAA33412	(Get FASTA)	NCBI Sequence Viewer
	CAA36076	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024733.6
	ENSRNOP00000071579
	ENSRNOP00000071579.1
	ENSRNOP00055011188
	ENSRNOP00060013507
	ENSRNOP00065028533
GenBank Protein	P15887	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037155 ⟸ NM_013023

- UniProtKB:

P15887 (UniProtKB/Swiss-Prot), R4GNK4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAACVKTNKSHVIFKKVSRDKSVTIYLGKRDYIDHVSQVEPVDGVVLVDPELVKGKKVYVTLTC
AFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAMSAPTQLQLSLLKKLGDNTYPFLLTFPDYLP
CSVMLQPAPQDVGKSCGVDFEVKAFATDITDAEEDKIPKKSSVRLLIRKVQHAPPEMGPQPCAE
ASWQFFMSDKPLHLSVSLSKEIYFHGEPIPVTVTVTNNTEKVVKKIKVSVEQIANVVLYSSDYY
VKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRT
VMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNL
KDTGENTEGKKDEDAGQDE

hide sequence

RefSeq Acc Id:

ENSRNOP00000024733 ⟸ ENSRNOT00000024733

RefSeq Acc Id:

ENSRNOP00000072320 ⟸ ENSRNOT00000087366

RefSeq Acc Id:

ENSRNOP00000071579 ⟸ ENSRNOT00000085770

RefSeq Acc Id:	XP_038938997 ⟸ XM_039083069
- Peptide Label:	isoform X1
- UniProtKB:	P15887 (UniProtKB/Swiss-Prot), R4GNK4 (UniProtKB/TrEMBL)

Protein Domains

Arrestin C-terminal-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P15887-F1-model_v2	AlphaFold	P15887	1-403	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3619	AgrOrtholog
BioCyc Gene	G2FUF-26832	BioCyc
Ensembl Genes	ENSRNOG00000018185	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055008233	UniProtKB/Swiss-Prot
	ENSRNOG00060010282	UniProtKB/Swiss-Prot
	ENSRNOG00065020862	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024733.7	UniProtKB/TrEMBL
	ENSRNOT00000085770	ENTREZGENE
	ENSRNOT00000085770.2	UniProtKB/Swiss-Prot
	ENSRNOT00055013948	UniProtKB/Swiss-Prot
	ENSRNOT00060017383	UniProtKB/Swiss-Prot
	ENSRNOT00065035425	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.640	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.40.840	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Arrestin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin-like_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin_C-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_E-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25539	UniProtKB/Swiss-Prot
NCBI Gene	25539	ENTREZGENE
PANTHER	PTHR11792	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S-ARRESTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Arrestin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arrestin_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sag	PhenoGen
PRINTS	ARRESTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ARRESTINS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018185	RatGTEx
	ENSRNOG00055008233	RatGTEx
	ENSRNOG00060010282	RatGTEx
	ENSRNOG00065020862	RatGTEx
SMART	Arrestin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF81296	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC218978
UniProt	ARRS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	R4GNK4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-09-26	Sag	S-antigen visual arrestin	Sag	S-antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-09-22	Sag	S-antigen	Sag	S-antigen; retina and pineal gland (arrestin)	Name changed	629549	APPROVED
2008-09-18	Sag	S-antigen; retina and pineal gland (arrestin)	Sag	retinal S-antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Sag	S-antigen			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	mutations of the human homolog are detected in Oguchi disease, a rare autosomal recessive form of congenital stationary night blindness	734491

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations