Nfia (nuclear factor I/A) - Rat Genome Database

Name: Nfia
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nfia (nuclear factor I/A) Rattus norvegicus

Analyze

Symbol:

Nfia

Name:

nuclear factor I/A

RGD ID:

3170

Description:

Enables DNA binding activity. Involved in positive regulation of DNA-templated transcription and response to organic cyclic compound. Predicted to be located in cell junction and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in NFIA-related disorder. Orthologous to human NFIA (nuclear factor I A); PARTICIPATES IN forkhead class A signaling pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CCAAT-box-binding transcription factor; CTF; NF-I/A; NF1-A; NFI-A; nuclear factor 1 A-type; nuclear factor 1/A; Nuclear Factor IA; TGGCA-binding protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NFIA (nuclear factor I A)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Nfia (nuclear factor I/A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nfia (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NFIA (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NFIA (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nfia (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NFIA (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NFIA (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nfia (nuclear factor I A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nfia (nuclear factor I/A)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NFIA (nuclear factor I A)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	nfia (nuclear factor I/A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nfi-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	NfI	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nfia	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Candidate Gene For:

Bp157

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	112,436,655 - 112,781,878 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	112,436,644 - 112,775,885 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	115,002,895 - 115,335,577 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	116,728,227 - 117,060,911 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	116,790,806 - 117,123,482 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	116,421,895 - 116,750,381 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	116,420,690 - 116,751,416 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	120,364,854 - 120,694,011 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	118,152,938 - 118,507,056 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	118,170,466 - 118,513,317 (+)	NCBI
Celera	5	111,023,750 - 111,350,695 (+)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

Macrocephaly (ISO)

Neurodevelopmental Disorders (ISO)

NFIA-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2-ethoxyethanol (EXP)

2-methoxyethanol (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-vinylcyclohexene dioxide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bortezomib (ISO)

butanal (ISO)

caffeine (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (EXP)

choline (ISO)

chromium(6+) (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dimethylarsinic acid (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

gamma-hexachlorocyclohexane (EXP)

gentamycin (EXP)

hydrogen cyanide (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lead(0) (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

melphalan (ISO)

mercury dichloride (EXP)

methapyrilene (EXP)

methimazole (EXP)

methoxychlor (EXP,ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

ochratoxin A (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

pentanal (ISO)

perfluorooctanoic acid (ISO)

permethrin (EXP,ISO)

phenethyl caffeate (EXP)

phenobarbital (ISO)

piperonyl butoxide (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium cyanide (ISO)

propiconazole (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

senecionine (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulforaphane (EXP)

sunitinib (ISO)

tauroursodeoxycholic acid (EXP)

testosterone (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triadimefon (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

triticonazole (EXP)

troglitazone (ISO)

trovafloxacin (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

BMP signaling pathway (IEA,ISO)

cartilage development (IEA,ISO)

cell morphogenesis (IEA,ISO)

DNA replication (IEA)

DNA-templated transcription (IEA)

exit from mitosis (IEA,ISO)

gene expression (ISO)

generation of neurons (ISO)

glial cell fate specification (IEA,ISO)

glial cell proliferation (IEA,ISO)

limb morphogenesis (IEA,ISO)

neural precursor cell proliferation (IEA,ISO)

neurogenesis (ISO)

neuron fate specification (IEA,ISO)

positive regulation of DNA-templated transcription (IDA,IEA)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

response to organic cyclic compound (IEP)

response to wounding (IEA,ISO)

retina development in camera-type eye (IEA,ISO)

synapse maturation (IEA,ISO)

ureter development (IEA,ISO)

Cellular Component

cell junction (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IDA,IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

DNA-binding transcription factor binding (IEA,ISO)

protein binding (IPI,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

forkhead class A signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of NFI-binding sites and cloning of NFI-cDNAs suggest a regulatory role for NFI transcription factors in olfactory neuron gene expression.	Baumeister H, etal., Brain Res Mol Brain Res 1999 Sep 8;72(1):65-79.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	A complex interplay of positive and negative elements is responsible for the different transcriptional activity of liver NF1 variants.	Monaci P, etal., Mol Biol Rep 1995;21(3):147-58.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Expression, DNA-binding specificity and transcriptional regulation of nuclear factor 1 family proteins from rat.	Osada S, etal., Biochem J 1999 Aug 15;342 ( Pt 1)(21):189-98.
8.	Nuclear factor 1 family proteins bind to the silencer element in the rat glutathione transferase P gene.	Osada S, etal., J Biochem (Tokyo) 1997 Feb;121(2):355-63.
9.	Purification of a NF1-like DNA-binding protein from rat liver and cloning of the corresponding cDNA.	Paonessa G, etal., EMBO J 1988 Oct;7(10):3115-23.
10.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Gene expression profiles following exposure to a developmental neurotoxicant, Aroclor 1254: pathway analysis for possible mode(s) of action.	Royland JE and Kodavanti PR, Toxicol Appl Pharmacol. 2008 Sep 1;231(2):179-96. Epub 2008 May 6.
15.	Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.	Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
16.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:8306889	PMID:9056636	PMID:11835404	PMID:12955085	PMID:15123731	PMID:15684392	PMID:16147868	PMID:16169882	PMID:17010934	PMID:17530927	PMID:19706729	PMID:23407945
PMID:35669369

Genomics

Comparative Map Data

Nfia
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	112,436,655 - 112,781,878 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	112,436,644 - 112,775,885 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	115,002,895 - 115,335,577 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	116,728,227 - 117,060,911 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	116,790,806 - 117,123,482 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	116,421,895 - 116,750,381 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	116,420,690 - 116,751,416 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	120,364,854 - 120,694,011 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	118,152,938 - 118,507,056 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	118,170,466 - 118,513,317 (+)	NCBI
Celera	5	111,023,750 - 111,350,695 (+)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

NFIA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	61,077,227 - 61,462,788 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	60,865,259 - 61,462,788 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	61,542,899 - 61,928,460 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	61,320,881 - 61,694,624 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	61,260,315 - 61,634,057	NCBI
Celera	1	59,831,591 - 60,216,841 (+)	NCBI		Celera
Cytogenetic Map	1	p31.3	NCBI
HuRef	1	59,635,821 - 60,040,693 (+)	NCBI		HuRef
CHM1_1	1	61,658,337 - 62,043,823 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	60,956,019 - 61,341,601 (+)	NCBI		T2T-CHM13v2.0

Nfia
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	97,469,534 - 98,007,113 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	97,660,971 - 98,007,111 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	97,578,066 - 98,118,876 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	97,772,734 - 98,118,874 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	97,248,634 - 97,785,567 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	97,269,917 - 97,604,410 (+)	NCBI		MGSCv36	mm8
Celera	4	95,943,228 - 96,479,959 (+)	NCBI		Celera
Cytogenetic Map	4	C5- C6	NCBI
cM Map	4	45.52	NCBI

Nfia
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	27,806,873 - 28,112,268 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	27,799,976 - 28,108,307 (-)	NCBI	ChiLan1.0	ChiLan1.0

NFIA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	164,550,471 - 164,927,450 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	60,331,945 - 60,713,729 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	62,159,978 - 62,534,170 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	61,938,945 - 62,526,753 (+)	Ensembl	panpan1.1		panPan2

NFIA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	48,489,521 - 49,064,867 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	48,496,773 - 49,064,848 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	48,556,341 - 48,929,909 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	48,679,005 - 49,048,341 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	48,678,684 - 49,048,459 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	48,627,327 - 48,995,641 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	48,573,147 - 48,946,371 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	48,838,229 - 49,211,486 (-)	NCBI		UU_Cfam_GSD_1.0

Nfia
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	74,245,514 - 74,803,937 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	615,012 - 957,282 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936522	612,357 - 1,171,079 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NFIA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	150,835,494 - 151,426,749 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	150,834,002 - 151,229,773 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	138,764,564 - 139,158,806 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NFIA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	71,573,729 - 72,171,268 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	45,443,121 - 45,829,474 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nfia
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	31,898,892 - 32,189,295 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	31,895,791 - 32,198,156 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nfia
1660 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	441
Count of miRNA genes:	236
Interacting mature miRNAs:	311
Transcripts:	ENSRNOT00000004017
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1582212	Livw2	Liver weight QTL 2	3.5	0.0004	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	5	99016066	119085810	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
7394708	Emca11	Estrogen-induced mammary cancer QTL 11			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	99753548	113061097	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
7794743	Bp373	Blood pressure QTL 373		0.0058	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	112175546	116047089	Rat

Markers in Region

D5Wox18

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	112,450,727 - 112,450,995 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	116,425,636 - 116,425,903	NCBI	Rnor6.0
Rnor_5.0	5	120,368,595 - 120,368,862	UniSTS	Rnor5.0
RGSC_v3.4	5	118,168,978 - 118,169,246	RGD	RGSC3.4
RGSC_v3.4	5	118,168,979 - 118,169,246	UniSTS	RGSC3.4
RGSC_v3.1	5	118,174,205 - 118,174,472	RGD
Celera	5	111,027,491 - 111,027,762	UniSTS
RH 3.4 Map	5	788.0	UniSTS
RH 3.4 Map	5	788.0	RGD
RH 2.0 Map	5	719.7	RGD
Cytogenetic Map	5	q33-q34	UniSTS

RH80440

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	112,513,923 - 112,514,012 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	116,488,657 - 116,488,745	NCBI	Rnor6.0
Rnor_5.0	5	120,432,192 - 120,432,280	UniSTS	Rnor5.0
RGSC_v3.4	5	118,244,253 - 118,244,341	UniSTS	RGSC3.4
Celera	5	111,089,762 - 111,089,850	UniSTS
Cytogenetic Map	5	q33-q34	UniSTS

RH143730

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	112,570,624 - 112,570,776 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	116,545,328 - 116,545,479	NCBI	Rnor6.0
Rnor_5.0	5	120,488,863 - 120,489,014	UniSTS	Rnor5.0
RGSC_v3.4	5	118,301,190 - 118,301,341	UniSTS	RGSC3.4
Celera	5	111,146,471 - 111,146,622	UniSTS
RH 3.4 Map	5	789.1	UniSTS
Cytogenetic Map	5	q33-q34	UniSTS

BI288968

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	112,466,595 - 112,466,784 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	116,441,496 - 116,441,684	NCBI	Rnor6.0
Rnor_5.0	5	120,384,343 - 120,384,531	UniSTS	Rnor5.0
RGSC_v3.4	5	118,184,905 - 118,185,093	UniSTS	RGSC3.4
Celera	5	111,043,343 - 111,043,531	UniSTS
RH 3.4 Map	5	789.1	UniSTS
Cytogenetic Map	5	q33-q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	42	37	25	15	25	8	10	68	35	31	11	8
Low		1	20	16	4	16		1	6		10
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB005129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB060652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF112455	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF112456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY572794	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D78020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X13167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000004017 ⟹ ENSRNOP00000004017

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,441,846 - 112,775,885 (+)	Ensembl
Rnor_6.0 Ensembl	5	116,421,900 - 116,751,398 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000080577 ⟹ ENSRNOP00000069038

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,441,846 - 112,678,845 (+)	Ensembl
Rnor_6.0 Ensembl	5	116,421,894 - 116,653,813 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086628 ⟹ ENSRNOP00000073066

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,441,846 - 112,775,885 (+)	Ensembl
Rnor_6.0 Ensembl	5	116,421,894 - 116,751,416 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000087089 ⟹ ENSRNOP00000073444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,441,743 - 112,775,745 (+)	Ensembl
Rnor_6.0 Ensembl	5	116,420,690 - 116,721,038 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106921 ⟹ ENSRNOP00000082237

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,441,743 - 112,731,526 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108479 ⟹ ENSRNOP00000084507

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,441,846 - 112,775,885 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117135 ⟹ ENSRNOP00000097022

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	112,436,644 - 112,775,885 (+)	Ensembl

RefSeq Acc Id:

NM_012988 ⟹ NP_037120

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	112,441,754 - 112,774,868 (+)	NCBI
Rnor_6.0	5	116,421,895 - 116,750,381 (+)	NCBI
Rnor_5.0	5	120,364,854 - 120,694,011 (+)	NCBI
RGSC_v3.4	5	118,152,938 - 118,507,056 (+)	RGD
Celera	5	111,023,750 - 111,350,695 (+)	RGD

Sequence:

show sequence

CCGAGTTGGAAATGTGAACGCAAGAAGCAGGCTTGATTTTTTTTTCCTCCCCCCTCTCCTAGCT
CTCTCCTCCTCTCTCTCCCTCTCGCACCCACACTCACGCACACCTCCAGCCCGCACACAGACGT
GCACGCACCCCCCGCCGCCCGGCAGTTATGTATTCTCCGCTCTGTCTCACCCAGGATGAGTTTC
ATCCTTTCATTGAAGCACTTCTGCCCCATGTCCGCGCCTTCGCCTACACATGGTTCAACCTGCA
GGCCCGAAAGCGGAAATACTTCAAAAAGCATGAGAAGCGCATGTCGAAAGAAGAGGAGAGGGCT
GTGAAGGATGAACTGCTAAGTGAGAAGCCTGAGGTCAAGCAAAAGTGGGCTTCCCGACTTCTGG
CCAAGTTACGGAAAGATATCCGACCCGAGTACCGAGAGGATTTTGTTCTTACAGTTACAGGGAA
AAAACCTCCATGCTGTGTTCTTTCCAACCCAGACCAGAAAGGCAAGATGCGGAGAATTGACTGC
CTCCGCCAGGCAGATAAAGTATGGAGGTTGGACCTCGTCATGGTGATCTTGTTCAAAGGTATTC
CGCTGGAAAGTACTGATGGTGAACGCCTTGTGAAGTCCCCACAGTGCTCGAATCCAGGGCTCTG
TGTCCAGCCCCATCACATAGGGGTTTCTGTAAAGGAACTCGATTTATATTTGGCATACTTTGTA
CATGCAGCAGATTCAAGTCAATCTGAAAGTCCCAGCCAACCAAGTGATGCTGACATTAAGGACC
AGCCAGAAAATGGACATTTGGGCTTCCAGGACAGCTTCGTCACATCAGGTGTTTTCAGTGTGAC
TGAGCTAGTAAGAGTGTCACAAACACCAATAGCTGCAGGAACCGGCCCCAATTTTTCTCTCTCT
GATTTGGAAAGTTCCTCATACTACAGCATGAGTCCAGGAGCAATGAGGAGGTCTCTACCCAGCA
CATCCTCTACCAGCTCTACCAAGCGCCTCAAGTCTGTGGAGGACGAAATGGACAGTCCTGGTGA
AGAACCATTTTACACAGGCCAAGGGCGCTCCCCAGGGAGTGGCAGCCAGTCCAGCGGATGGCAT
GAAGTAGAGCCAGGCATGCCATCTCCAACCACTCTGAAGAAGTCTGAGAAGTCTGGTTTCAGCA
GCCCCTCCCCTTCGCAGACCTCCTCCCTCGGAACAGCATTCACACAGCATCACCGACCTGTCAT
AACAGGACCGAGAGCAAGCCCACATGCGACGCCATCGACTCTCCACTTTCCAACGTCACCTATC
ATCCAGCAGCCTGGGCCTTATTTCTCACACCCAGCCATCCGTTACCACCCTCAGGAGACGCTGA
AGGAGTTTGTCCAACTTGTCTGCCCCGATGCTGGTCAGCAAGCTGGACAGGTGGGGTTCCTCAA
TCCCAATGGAAGCAGTCAAGGCAAGGTGCACAACCCATTCCTCCCCACCCCAATGTTGCCGCCG
CCACCGCCACCACCGATGGCCAGGCCTGTGCCTCTGCCCATGCCAGACACCAAGCCTCCAACCA
CATCAACAGAAGGCGGTGCAGCCTCCCCCACCTCACCGACCTACTCGACACCCAGCACCTCCCC
CGCAAACCGATTCGTCAGTGTTGGACCACGGGATCCAAGCTTTGTAAATATCCCTCAACAGACA
CAGTCCTGGTACCTGGGATAAAAGTTGCAGCGTCCCACCATCCTCCAGACAGACCACCTGACCC
CTTCTCAACTCTGTAACATGGACGCAACCTCAACCCGGCGCAGTTACAACTTCACTGTCAGTGG
AAGGGGAGAGACACCAACTCGAATCAACTTGTACATGGAAACAGCGAACGTCGTGGTCAAACAG
CAAAGGCCATAACTTTTCGGGATTCTTTTTTTTTTTTTAATACTTTAGGGACTGTCGTAATTTC
TCATATGGTGCTGGAAATGGTTGGGCTGTGTGACATTTGAAGTGTTCCAGTGGTGGTGTGAGCA
GTAGGTGAAGCGGCTGGTAGGGGATGAGCCTTGCTCACGAACTTCCTGTTGTAACACTTGTGAG
CCTGGCCTTTTCACAGTATTTCAAGAATTTGCCCGCGCAGGTGTGTGACCCTCCCGGAGCACTT
GGAGACACCTGGAGAATGAAATCTTTCGTAGTAGCTAAGATCTGTGATCTGTAACTTACAGGAC
ACTCAAAGGGCAATGTTTTTTGGG

hide sequence

RefSeq Acc Id:

XM_039109300 ⟹ XP_038965228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	112,436,655 - 112,781,878 (+)	NCBI

RefSeq Acc Id:

XM_039109301 ⟹ XP_038965229

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	112,440,929 - 112,781,878 (+)	NCBI

RefSeq Acc Id:

XM_039109302 ⟹ XP_038965230

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	112,571,370 - 112,781,878 (+)	NCBI

RefSeq Acc Id:

XM_039109303 ⟹ XP_038965231

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	112,459,854 - 112,781,878 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037120	(Get FASTA)	NCBI Sequence Viewer
	XP_038965228	(Get FASTA)	NCBI Sequence Viewer
	XP_038965229	(Get FASTA)	NCBI Sequence Viewer
	XP_038965230	(Get FASTA)	NCBI Sequence Viewer
	XP_038965231	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF21949	(Get FASTA)	NCBI Sequence Viewer
	AAF23585	(Get FASTA)	NCBI Sequence Viewer
	AAS77864	(Get FASTA)	NCBI Sequence Viewer
	BAA11203	(Get FASTA)	NCBI Sequence Viewer
	BAA11204	(Get FASTA)	NCBI Sequence Viewer
	BAA11205	(Get FASTA)	NCBI Sequence Viewer
	BAA11206	(Get FASTA)	NCBI Sequence Viewer
	BAA21102	(Get FASTA)	NCBI Sequence Viewer
	BAB43904	(Get FASTA)	NCBI Sequence Viewer
	CAA31565	(Get FASTA)	NCBI Sequence Viewer
	EDL97790	(Get FASTA)	NCBI Sequence Viewer
	P09414	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037120 ⟸ NM_012988

- UniProtKB:

Q54A99 (UniProtKB/Swiss-Prot), Q63782 (UniProtKB/Swiss-Prot), P09414 (UniProtKB/Swiss-Prot), A0A8I6G968 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEK
PEVKQKWASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWR
LDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSE
SPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYS
MSPGAMRRSLPSTSSTSSTKRLKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSP
TTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFS
HPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPNGSSQGKVHNPFLPTPMLPPPPPPPMARP
VPLPMPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVGPRDPSFVNIPQQTQSWYLG

hide sequence

RefSeq Acc Id:

ENSRNOP00000004017 ⟸ ENSRNOT00000004017

RefSeq Acc Id:

ENSRNOP00000069038 ⟸ ENSRNOT00000080577

RefSeq Acc Id:

ENSRNOP00000073444 ⟸ ENSRNOT00000087089

RefSeq Acc Id:

ENSRNOP00000073066 ⟸ ENSRNOT00000086628

RefSeq Acc Id:	XP_038965228 ⟸ XM_039109300
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AR84 (UniProtKB/TrEMBL), A0A8I6G968 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965229 ⟸ XM_039109301
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2K5I9 (UniProtKB/TrEMBL), Q63573 (UniProtKB/TrEMBL), A0A8I6G968 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965231 ⟸ XM_039109303
- Peptide Label:	isoform X4
- UniProtKB:	Q63785 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965230 ⟸ XM_039109302
- Peptide Label:	isoform X3

RefSeq Acc Id:

ENSRNOP00000082237 ⟸ ENSRNOT00000106921

RefSeq Acc Id:

ENSRNOP00000084507 ⟸ ENSRNOT00000108479

RefSeq Acc Id:

ENSRNOP00000097022 ⟸ ENSRNOT00000117135

Protein Domains

CTF/NF-I

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P09414-F1-model_v2	AlphaFold	P09414	1-509	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3170	AgrOrtholog
BioCyc Gene	G2FUF-40597	BioCyc
Ensembl Genes	ENSRNOG00000006966	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000004017	ENTREZGENE
	ENSRNOP00000004017.8	UniProtKB/TrEMBL
	ENSRNOP00000069038.2	UniProtKB/TrEMBL
	ENSRNOP00000073066.2	UniProtKB/TrEMBL
	ENSRNOP00000073444	ENTREZGENE
	ENSRNOP00000073444.2	UniProtKB/TrEMBL
	ENSRNOP00000082237.1	UniProtKB/TrEMBL
	ENSRNOP00000084507.1	UniProtKB/TrEMBL
	ENSRNOP00000097022	ENTREZGENE
	ENSRNOP00000097022.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004017	ENTREZGENE
	ENSRNOT00000004017.8	UniProtKB/TrEMBL
	ENSRNOT00000080577.2	UniProtKB/TrEMBL
	ENSRNOT00000086628.2	UniProtKB/TrEMBL
	ENSRNOT00000087089	ENTREZGENE
	ENSRNOT00000087089.2	UniProtKB/TrEMBL
	ENSRNOT00000106921.1	UniProtKB/TrEMBL
	ENSRNOT00000108479.1	UniProtKB/TrEMBL
	ENSRNOT00000117135	ENTREZGENE
	ENSRNOT00000117135.1	UniProtKB/TrEMBL
InterPro	CTF/NFI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTF/NFI_DNA-bd-dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTF/NFI_DNA-bd_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTF/NFI_DNA-bd_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MAD_homology1_Dwarfin-type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25492	UniProtKB/Swiss-Prot
NCBI Gene	25492	ENTREZGENE
PANTHER	NUCLEAR FACTOR 1 A-TYPE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11492	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CTF_NFI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MH1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NfI_DNAbd_pre-N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nfia	PhenoGen
PROSITE	CTF_NFI_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTF_NFI_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	DWA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC229055
	TC229056
UniProt	A0A0G2K4J4_RAT	UniProtKB/TrEMBL
	A0A0G2K5I9	ENTREZGENE
	A0A8I6AR84	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G968	ENTREZGENE, UniProtKB/TrEMBL
	NFIA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q54A99	ENTREZGENE
	Q63573	ENTREZGENE, UniProtKB/TrEMBL
	Q63782	ENTREZGENE
	Q63783_RAT	UniProtKB/TrEMBL
	Q63784_RAT	UniProtKB/TrEMBL
	Q63785	ENTREZGENE, UniProtKB/TrEMBL
	Q6PWY0_RAT	UniProtKB/TrEMBL
	Q9QY89_RAT	UniProtKB/TrEMBL
	Q9QY90_RAT	UniProtKB/TrEMBL
UniProt Secondary	A0A0G2JUB7	UniProtKB/TrEMBL
	A0A0G2K5I9	UniProtKB/TrEMBL
	F1LRV0	UniProtKB/TrEMBL
	Q54A99	UniProtKB/Swiss-Prot
	Q63782	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-11-06	Nfia	nuclear factor I/A		Nuclear Factor IA	Name updated	625702	APPROVED
2002-06-10	Nfia	Nuclear Factor IA			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_process	involved in negative regulation of glutathione transferase P (GST-P) gene expression	729073

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)