Casq2 (calsequestrin 2) - Rat Genome Database

Name: Casq2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Casq2 (calsequestrin 2) Rattus norvegicus

Analyze

Symbol:

Casq2

Name:

calsequestrin 2

RGD ID:

2276

Description:

Enables protein homodimerization activity and protein kinase C binding activity. Involved in regulation of cardiac muscle cell contraction and regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion. Located in Z disc and sarcoplasmic reticulum. Biomarker of congestive heart failure and supravalvular aortic stenosis. Human ortholog(s) of this gene implicated in catecholaminergic polymorphic ventricular tachycardia 2. Orthologous to human CASQ2 (calsequestrin 2); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

calsequestrin 2 (cardiac muscle); calsequestrin, cardiac muscle isoform; calsequestrin-2; cardCSQ; SR calcium binding protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CASQ2 (calsequestrin 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Casq2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Casq2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CASQ2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CASQ2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Casq2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CASQ2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CASQ2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Casq2 (calsequestrin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CASQ2 (calsequestrin 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Casq2 (calsequestrin 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	casq2 (calsequestrin 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	csq-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	casq2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	192,214,556 - 192,270,821 (+)	NCBI		GRCr8
mRatBN7.2	2	189,526,003 - 189,582,276 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	189,525,960 - 189,582,267 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	197,154,083 - 197,210,463 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	195,012,238 - 195,067,913 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	189,839,671 - 189,896,025 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	204,512,361 - 204,568,643 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	204,512,302 - 204,568,656 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	223,945,611 - 224,001,893 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	197,182,938 - 197,239,201 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	197,145,718 - 197,201,199 (+)	NCBI
Celera	2	181,958,395 - 182,014,660 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

Cardiac Arrhythmias (ISO)

Cardiac Conduction Defect (ISO)

cardiomyopathy (ISO)

catecholaminergic polymorphic ventricular tachycardia (ISO)

catecholaminergic polymorphic ventricular tachycardia 1 (ISO)

catecholaminergic polymorphic ventricular tachycardia 2 (ISO,ISS)

caudal regression syndrome (ISO)

congestive heart failure (IEP)

Diabetic Cardiomyopathies (IDA)

dilated cardiomyopathy (ISO)

Familial Ventricular Tachycardia (ISO)

genetic disease (ISO)

Heart Block (ISO)

long QT syndrome (ISO)

neural tube defect (ISO)

progressive familial heart block (ISO)

RASopathy (ISO)

Sudden Death (ISO)

supravalvular aortic stenosis (IEP)

Ventricular Tachycardia (ISO)

Wolff-Parkinson-White syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

amphotericin B (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

etoposide (ISO)

flavonoids (EXP)

genistein (ISO)

maneb (ISO)

Mesaconitine (EXP)

N,N-diethyl-m-toluamide (EXP)

nickel atom (ISO)

nitrofen (EXP)

ozone (ISO)

paraquat (EXP,ISO)

permethrin (EXP)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cardiac muscle contraction (IEA,ISO)

cellular response to caffeine (IEA,ISO)

intracellular calcium ion homeostasis (ISO)

negative regulation of potassium ion transport (ISO)

protein polymerization (IEA,ISO)

regulation of cardiac muscle cell contraction (IMP)

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion (IBA,IEA,IMP,ISO)

regulation of cell communication by electrical coupling (IEA,ISO)

regulation of heart rate (IEA,ISO)

regulation of membrane repolarization (ISO)

regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum (ISO)

sarcomere organization (ISO)

sequestering of calcium ion (IEA,ISO)

Cellular Component

cytoplasm (ISO)

junctional membrane complex (ISO)

sarcoplasmic reticulum (IDA,ISO)

sarcoplasmic reticulum lumen (IBA,IEA,ISO)

Z disc (IBA,IDA,IEA,ISO)

Molecular Function

calcium ion binding (IBA,IEA,ISO)

calcium ion sequestering activity (IEA,ISO)

calcium-dependent protein binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IDA)

protein kinase C binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The catecholaminergic polymorphic ventricular tachycardia mutation R33Q disrupts the N-terminal structural motif that regulates reversible calsequestrin polymerization.	Bal NC, etal., J Biol Chem. 2010 May 28;285(22):17188-96. doi: 10.1074/jbc.M109.096354. Epub 2010 Mar 30.
2.	Sildenafil and FDP-Sr attenuate diabetic cardiomyopathy by suppressing abnormal expression of myocardial CASQ2, FKBP12.6, and SERCA2a in rats.	Cheng YS, etal., Acta Pharmacol Sin. 2011 Apr;32(4):441-8. Epub 2011 Mar 28.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	A missense mutation in a highly conserved region of CASQ2 is associated with autosomal recessive catecholamine-induced polymorphic ventricular tachycardia in Bedouin families from Israel.	Lahat H, etal., Am J Hum Genet 2001 Dec;69(6):1378-84. Epub 2001 Oct 25.
6.	Membrane associated Ca2+ buffers in the heart.	Lee D and Michalak M, BMB Rep. 2010 Mar;43(3):151-7.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Comprehensive gene review and curation	RGD comprehensive gene curation
15.	Characterization of the binding and phosphorylation of cardiac calsequestrin by epsilon protein kinase C.	Rodriguez MM, etal., FEBS Lett 1999 Jul 9;454(3):240-6.
16.	Distribution of proteins implicated in excitation-contraction coupling in rat ventricular myocytes.	Scriven DR, etal., Biophys J. 2000 Nov;79(5):2682-91.
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.	Age-related differences in the expression of proto-oncogene and contractile protein genes in response to pressure overload in the rat myocardium.	Takahashi T, etal., J Clin Invest. 1992 Mar;89(3):939-46.
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	Protein protein interactions between triadin and calsequestrin are involved in modulation of sarcoplasmic reticulum calcium release in cardiac myocytes.	Terentyev D, etal., J Physiol. 2007 Aug 15;583(Pt 1):71-80. Epub 2007 Jun 14.
21.	Changes in ion channel gene expression underlying heart failure-induced sinoatrial node dysfunction.	Yanni J, etal., Circ Heart Fail. 2011 Jul;4(4):496-508. Epub 2011 May 12.

Additional References at PubMed

PMID:8042990	PMID:9287354	PMID:9525981	PMID:15041652	PMID:15485681	PMID:15486014	PMID:15489334	PMID:15698842	PMID:16601229	PMID:16908766	PMID:16932808	PMID:17881003
PMID:18399795	PMID:19103607	PMID:19383796	PMID:19920148	PMID:20525644	PMID:21063088	PMID:21431367	PMID:22123818	PMID:23876860	PMID:25931508	PMID:26316108	PMID:28169003

Genomics

Comparative Map Data

Casq2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	192,214,556 - 192,270,821 (+)	NCBI		GRCr8
mRatBN7.2	2	189,526,003 - 189,582,276 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	189,525,960 - 189,582,267 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	197,154,083 - 197,210,463 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	195,012,238 - 195,067,913 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	189,839,671 - 189,896,025 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	204,512,361 - 204,568,643 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	204,512,302 - 204,568,656 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	223,945,611 - 224,001,893 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	197,182,938 - 197,239,201 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	197,145,718 - 197,201,199 (+)	NCBI
Celera	2	181,958,395 - 182,014,660 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

CASQ2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	115,700,021 - 115,768,714 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	115,700,021 - 115,768,884 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	116,242,642 - 116,311,335 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	116,044,147 - 116,112,929 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	115,954,684 - 116,023,312	NCBI
Celera	1	114,471,445 - 114,540,231 (-)	NCBI		Celera
Cytogenetic Map	1	p13.1	NCBI
HuRef	1	114,100,712 - 114,169,492 (-)	NCBI		HuRef
CHM1_1	1	116,357,421 - 116,426,262 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	115,707,724 - 115,776,700 (-)	NCBI		T2T-CHM13v2.0

Casq2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	101,993,731 - 102,053,830 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	101,993,731 - 102,053,830 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	102,086,415 - 102,146,514 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	102,086,415 - 102,146,514 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	101,890,433 - 101,950,437 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	102,205,026 - 102,275,310 (+)	NCBI		MGSCv36	mm8
Celera	3	104,291,185 - 104,350,741 (+)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	44.3	NCBI

Casq2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	18,941,936 - 18,996,200 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	18,941,975 - 18,996,027 (-)	NCBI	ChiLan1.0	ChiLan1.0

CASQ2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	108,347,728 - 108,421,140 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	107,950,341 - 108,020,647 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	86,795,392 - 86,864,196 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	121,844,494 - 121,913,311 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	121,844,097 - 121,913,311 (+)	Ensembl	panpan1.1		panPan2

CASQ2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	53,233,966 - 53,299,093 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	53,224,438 - 53,299,708 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	52,883,024 - 52,948,138 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	54,114,995 - 54,180,159 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	54,115,013 - 54,180,265 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	53,153,853 - 53,218,892 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	53,188,593 - 53,253,716 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	53,761,968 - 53,827,341 (-)	NCBI		UU_Cfam_GSD_1.0

Casq2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	13,419,602 - 13,487,289 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936627	1,001,678 - 1,069,438 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936627	1,001,681 - 1,069,377 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CASQ2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	104,918,501 - 104,983,607 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	104,918,204 - 104,984,019 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	115,007,604 - 115,070,817 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CASQ2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	17,937,089 - 18,008,433 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	17,937,524 - 18,008,786 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	20,654,546 - 20,724,412 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Casq2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	11,456,554 - 11,521,939 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	11,458,994 - 11,521,809 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Casq2
634 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	88
Interacting mature miRNAs:	106
Transcripts:	ENSRNOT00000021846
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
7488929	Bp366	Blood pressure QTL 366		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	184974550	193094998	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat

Markers in Region

D2Rat235

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	189,529,583 - 189,529,737 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	204,515,942 - 204,516,095	NCBI	Rnor6.0
Rnor_5.0	2	223,949,192 - 223,949,345	UniSTS	Rnor5.0
RGSC_v3.4	2	197,186,518 - 197,186,672	RGD	RGSC3.4
RGSC_v3.4	2	197,186,519 - 197,186,672	UniSTS	RGSC3.4
RGSC_v3.1	2	197,149,076 - 197,149,440	RGD
Celera	2	181,961,976 - 181,962,129	UniSTS
SHRSP x BN Map	2	72.7698	RGD
SHRSP x BN Map	2	72.7698	UniSTS
Cytogenetic Map	2	q34	UniSTS

D2Got127

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	189,544,741 - 189,544,885 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	204,531,003 - 204,531,146	NCBI	Rnor6.0
Rnor_5.0	2	223,964,253 - 223,964,396	UniSTS	Rnor5.0
RGSC_v3.4	2	197,201,672 - 197,201,816	RGD	RGSC3.4
RGSC_v3.4	2	197,201,673 - 197,201,816	UniSTS	RGSC3.4
RGSC_v3.1	2	197,164,427 - 197,164,570	RGD
Celera	2	181,977,144 - 181,977,287	UniSTS
RH 3.4 Map	2	1287.7	UniSTS
RH 3.4 Map	2	1287.7	RGD
RH 2.0 Map	2	972.9	RGD
Cytogenetic Map	2	q34	UniSTS

D2Got190

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	189,534,808 - 189,535,085 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	204,521,167 - 204,521,443	NCBI	Rnor6.0
Rnor_5.0	2	223,954,417 - 223,954,693	UniSTS	Rnor5.0
RGSC_v3.4	2	197,191,743 - 197,192,020	RGD	RGSC3.4
RGSC_v3.4	2	197,191,744 - 197,192,020	UniSTS	RGSC3.4
RGSC_v3.1	2	197,154,498 - 197,154,774	RGD
Celera	2	181,967,201 - 181,967,491	UniSTS
RH 3.4 Map	2	1290.1	UniSTS
RH 3.4 Map	2	1290.1	RGD
RH 2.0 Map	2	973.4	RGD
Cytogenetic Map	2	q34	UniSTS

AA924985

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	189,581,999 - 189,582,203 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	204,568,367 - 204,568,570	NCBI	Rnor6.0
Rnor_5.0	2	224,001,617 - 224,001,820	UniSTS	Rnor5.0
RGSC_v3.4	2	197,238,925 - 197,239,128	UniSTS	RGSC3.4
Celera	2	182,014,384 - 182,014,587	UniSTS
RH 3.4 Map	2	1288.8	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		4
Medium		37					8	9	4		2	7	8
Low	3	2	27	11	18	11		2	35	29	39	4
Below cutoff			10	10	1	10			33	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF001334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK602439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO401252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U33287	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021846 ⟹ ENSRNOP00000021846

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	189,525,960 - 189,582,267 (+)	Ensembl
Rnor_6.0 Ensembl	2	204,512,302 - 204,568,656 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096981 ⟹ ENSRNOP00000089016

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	189,525,962 - 189,582,097 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101544 ⟹ ENSRNOP00000097042

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	189,525,986 - 189,582,263 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111697 ⟹ ENSRNOP00000086716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	189,525,986 - 189,582,263 (+)	Ensembl

RefSeq Acc Id:

NM_017131 ⟹ NP_058827

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	192,214,556 - 192,270,821 (+)	NCBI
mRatBN7.2	2	189,526,003 - 189,582,276 (+)	NCBI
Rnor_6.0	2	204,512,361 - 204,568,643 (+)	NCBI
Rnor_5.0	2	223,945,611 - 224,001,893 (+)	NCBI
RGSC_v3.4	2	197,182,938 - 197,239,201 (+)	RGD
Celera	2	181,958,395 - 182,014,660 (+)	RGD

Sequence:

show sequence

TTTGTTCTGAGCCCACAACTACACAGCCGCAGGACCAAGGAGGTGAGATCAGCCTCTTTGTTCC
CTAACCAAGCTTAGCAGCGTCTCCAAGAACCTTCCATCTGTCTTCCATGATCTCCGTTCTGGGG
ACTGAGAAACAAGACTCTTCCCAAATGAAGAGGATTTACCTGCTCGTGGTGGGGCTTTATCTGC
TGTCCTTTAGCAGGGCAGAAGAGGGGCTGAACTTCCCCACGTACGATGGGAAGGACCGAGTGGT
CAGCCTTTCTGAGAAGAACTTGAAGCAAGTGTTGAAGAGATACGATTTGCTCTGTCTCTACTAC
CACGAGCCTGTGTCTTCAGACAAGGTCGCACAGAAGCAGTTCCAACTGAAGGAGATCGTACTGG
AGCTTGTGGCCCAGGTTCTGGAACATAAAAACATAGGCTTTGTGATGGTGGATTCAAGGAAAGA
GGCCAAGCTTGCCAAGAGGCTGGGCTTCAGTGAAGAAGGAAGCCTGTATGTTCTGAAGGGTGGT
CGCACCATTGAGTTTGACGGGGAATTTGCAGCAGATGTCTTGGTGGAATTTCTCTTGGACCTCA
TTGAGGACCCAGTAGAGATCGTGAACAACAAGTTGGAAGTCCAAGCCTTTGAGCGCATCGAGGA
CCAGATCAAGCTGCTTGGCTTTTTCAAGAATGAGGACTCAGAATATTACAAAGCGTTCCAAGAG
GCAGCTGAACACTTCCAGCCTTACATCAAGTTCTTTGCCACCTTTGACAAGGGGGTGGCAAAGA
AGTTGTCCTTGAAGATGAATGAAGTTGGCTTCTATGAGCCATTTATGGATGAACCCAGTGTCAT
CCCTAACAAGCCCTACACAGAAGAGGAGCTTGTGGAGTTTGTGAAGGAGCATCAAAGACCCACC
CTACGTCGCTTGCGCCCAGAGGACATGTTTGAAACATGGGAAGACGACTTGAATGGAATCCACA
TTGTGGCATTTGCGGAGAAGAGTGACCCAGATGGCTATGAGTTCCTGGAGATCCTAAAACAGGT
TGCCCGGGACAACACTGACAACCCTGACTTGAGCATCTTGTGGATTGACCCAGACGACTTTCCT
CTGCTTGTTGCTTACTGGGAGAAGACTTTCAAGATTGACCTGTTCAAGCCACAGATTGGGGTGG
TGAATGTAACCGATGCTGACAGTGTCTGGATGGAGATCCCAGATGATGACGACCTGCCCACAGC
TGAGGAGCTGGAAGACTGGATTGAGGATGTGCTTTCTGGAAAGATCAATACTGAAGACGATGAC
AATGAAGATGAAGATGATGATGGCGATAATGACAATGACGATGACGATGACGACGATGATAATT
CTGATGAGGATAATGATGACAGTGATGATGACGATGATGACGATGAATAACTCCAGCCCCGGGT
ACTTCTGATGAGAGTGACATCACAACCACCCCGTACCCCATTACAGACAGCCCAAGGGGGCAGC
AAGCAGTGGTGCCCACACCTAGTCAGCTCTTTTCCTTTCTCCAGCATCTTTTCCAAGTCCGTTC
TTGGCAGGAGCAGTACATTTCCGTGAATGCCTTTCCAAACCCAGCTGTCCCACTCTGCAGGGAC
AGAAGGGGGAGGGGGGCGGTGATTCCCATGCTGACTCCTTTTAACTATTGAGGAACAAACAGCT
CTTGTTCTTTGTTAGATAATCAGGGGTCATGGAATTCTGGGAGTCTGGGCACAGTATCTCCTGA
CACCTCTACTCAAGTTTACTTGTTGTTTTTGATTCAGATGGTGACAGAACTGACAGCTTGCTAT
TAGTTCACAAGCAGAGAGTGGCCTTCTAATCAGAGCCCAGAAAGGCCACATGATTATCTAATTC
AGCTCCCAAACCCAGAGCATCTGTGGACTCAGACCCAAGCCTTGGATGGCTATGGGTACTGCCA
TCATTTCTGGAATATTAGGATGCTGTGTGGGGGTCATTTAGCTCTATAAACATCCCATTAATTG
CCAAGCCTCATATATTCACCAGCAGTGAGGAGAGAGACTGAAGGCTAAAAGGCTTTTCATTTTT
CTGACGGAGACTGTTCAGGTCTGCTGGCTGCCTACAGTGCGCTGGGAACTGAATGCACCCTCTC
TGTCCTGCTAGCGAGCTGTCCCATTCTGAGTTAAAACCACTCTATCCAATGGTCAATTAACTCT
CCCCATTCATCAGCACTCCTGCAGTTGACCAGGGCATCGATAATTTAGAGTTCACGATGCTCTG
AGGAACTGAGAAAAAAAAAAAAAAGAACCCCCAAGTGCCTTTTGGATTGTCTGAAAGCAGCACT
GTGCTCGGTAGTGATAGTCGCTAAGTGTTCTAATTTATTTTTGAAATCTGTTAACATGGAGAAG
ACTCTGTGTGGTGTTGTTTTTGAAACTGGGGCAGTCCTTTTATGGAACAGCAATAAACTAATGG
ACATTAAACTCATGCTTTGAAAGGAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058827	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA75480	(Get FASTA)	NCBI Sequence Viewer
	AAB58746	(Get FASTA)	NCBI Sequence Viewer
	AAH72547	(Get FASTA)	NCBI Sequence Viewer
	EDL85514	(Get FASTA)	NCBI Sequence Viewer
	EDL85515	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021846
	ENSRNOP00000021846.7
	ENSRNOP00000086716.1
	ENSRNOP00000089016.1
	ENSRNOP00000097042.1
GenBank Protein	P51868	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058827 ⟸ NM_017131
- Peptide Label:	precursor
- UniProtKB:	Q6IMX1 (UniProtKB/Swiss-Prot), O09177 (UniProtKB/Swiss-Prot), P51868 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKRIYLLVVGLYLLSFSRAEEGLNFPTYDGKDRVVSLSEKNLKQVLKRYDLLCLYYHEPVSSDK VAQKQFQLKEIVLELVAQVLEHKNIGFVMVDSRKEAKLAKRLGFSEEGSLYVLKGGRTIEFDGE FAADVLVEFLLDLIEDPVEIVNNKLEVQAFERIEDQIKLLGFFKNEDSEYYKAFQEAAEHFQPY IKFFATFDKGVAKKLSLKMNEVGFYEPFMDEPSVIPNKPYTEEELVEFVKEHQRPTLRRLRPED MFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEK TFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDNEDEDDDG DNDNDDDDDDDDNSDEDNDDSDDDDDDDE hide sequence

RefSeq Acc Id:

ENSRNOP00000021846 ⟸ ENSRNOT00000021846

RefSeq Acc Id:

ENSRNOP00000097042 ⟸ ENSRNOT00000101544

RefSeq Acc Id:

ENSRNOP00000089016 ⟸ ENSRNOT00000096981

RefSeq Acc Id:

ENSRNOP00000086716 ⟸ ENSRNOT00000111697

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51868-F1-model_v2	AlphaFold	P51868	1-413	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691618

Promoter ID:

EPDNEW_R2143

Type:

initiation region

Name:

Casq2_1

Description:

calsequestrin 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	204,512,357 - 204,512,417	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2276	AgrOrtholog
BIND	133998
	134040
	134041
BioCyc Gene	G2FUF-51841	BioCyc
Ensembl Genes	ENSRNOG00000016243	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021846	ENTREZGENE
	ENSRNOT00000021846.7	UniProtKB/TrEMBL
	ENSRNOT00000096981.1	UniProtKB/TrEMBL
	ENSRNOT00000101544.1	UniProtKB/TrEMBL
	ENSRNOT00000111697.1	UniProtKB/TrEMBL
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7105911	IMAGE-MGC_LOAD
InterPro	Calsequestrin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calsequestrin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calsequestrin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calsequestrin_middle_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calsequestrin_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29209	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91724	IMAGE-MGC_LOAD
NCBI Gene	29209	ENTREZGENE
PANTHER	CALSEQUESTRIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CALSEQUESTRIN-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Calsequestrin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	CASQ2	RGD
PhenoGen	Casq2	PhenoGen
PRINTS	CALSEQUESTRN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CALSEQUESTRIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CALSEQUESTRIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016243	RatGTEx
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC229963
UniProt	A0A8I6A1S3_RAT	UniProtKB/TrEMBL
	A0A8I6A994_RAT	UniProtKB/TrEMBL
	A0A8I6AS63_RAT	UniProtKB/TrEMBL
	A6K3I5_RAT	UniProtKB/TrEMBL
	A6K3I6_RAT	UniProtKB/TrEMBL
	CASQ2_RAT	UniProtKB/Swiss-Prot
	F1M944_RAT	UniProtKB/TrEMBL
	O09177	ENTREZGENE
	P51868	ENTREZGENE
	Q6IMX1	ENTREZGENE
UniProt Secondary	O09177	UniProtKB/Swiss-Prot
	Q6IMX1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-09	Casq2	calsequestrin 2	Casq2	calsequestrin 2 (cardiac muscle)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Casq2	calsequestrin 2 (cardiac muscle)	Casq2	calsequestrin 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	binds activated epsilon protein kinase C holoenzyme	69798

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations