Cks2 (CDC28 protein kinase regulatory subunit 2)

Gene: Cks2 (CDC28 protein kinase regulatory subunit 2) Rattus norvegicus

Analyze

Symbol:

Cks2

Name:

CDC28 protein kinase regulatory subunit 2

RGD ID:

1562047

Description:

Predicted to enable several functions, including cyclin-dependent protein serine/threonine kinase activator activity; histone binding activity; and ubiquitin binding activity. Predicted to be involved in regulation of mitotic cell cycle. Predicted to act upstream of or within several processes, including fibroblast proliferation; mitotic cell cycle phase transition; and regulation of transcription by RNA polymerase II. Predicted to be part of SCF ubiquitin ligase complex and cyclin-dependent protein kinase holoenzyme complex. Orthologous to human CKS2 (CDC28 protein kinase regulatory subunit 2); PARTICIPATES IN small cell lung carcinoma pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cyclin-dependent kinases regulatory subunit 2; LOC498709; RGD1562047; similar to Cyclin-dependent kinases regulatory subunit 2 (CKS-2)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CKS2 (CDC28 protein kinase regulatory subunit 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cks2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cks2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CKS2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CKS2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cks2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CKS2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CKS2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cks2 (CDC28 protein kinase regulatory subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CKS2 (CDC28 protein kinase regulatory subunit 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Cks2 (CDC28 protein kinase regulatory subunit 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:86839	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CKS1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cks30A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cks-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y71G12B.27	Alliance	DIOPT (InParanoid\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cks2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	13,722,360 - 13,727,519 (-)	NCBI		GRCr8
mRatBN7.2	17	13,570,611 - 13,575,770 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	17	13,499,535 - 13,504,692 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	15,110,401 - 15,115,560 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	13,426,332 - 13,431,489 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	13,587,664 - 13,593,423 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	13,587,665 - 13,593,423 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	15,662,365 - 15,667,466 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	19,423,502 - 19,429,451 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	13,326,389 - 13,331,548 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

genetic disease (ISO)

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

2-palmitoylglycerol (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antimony(0) (ISO)

antimycin A (ISO)

aristolochic acid A (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bicalutamide (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

butan-1-ol (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chloroprene (ISO)

chlorpromazine (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

corticosterone (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cytarabine (ISO)

D-glucose (ISO)

deguelin (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

diethyl maleate (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (EXP)

dioxygen (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

disodium selenite (ISO)

elemental selenium (ISO)

endosulfan (EXP)

Enterolactone (ISO)

ethanol (ISO)

fenpyroximate (ISO)

flutamide (EXP)

fluvastatin (ISO)

gentamycin (EXP)

glucose (ISO)

GW 4064 (ISO)

hydroxyurea (ISO)

irinotecan (EXP)

iron dichloride (ISO)

isobutanol (ISO)

ivermectin (ISO)

leflunomide (EXP,ISO)

levofloxacin (EXP)

Licochalcone B (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methapyrilene (EXP)

methimazole (EXP)

mitomycin C (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-Nitrosopyrrolidine (ISO)

naphthalene (EXP)

nefazodone (EXP)

nickel atom (ISO)

nickel dichloride (ISO)

nicotine (ISO)

nimesulide (EXP)

ochratoxin A (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenformin (EXP)

phenobarbital (ISO)

PhIP (EXP)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

pinosylvin (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP,ISO)

pyrimidifen (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

retinyl acetate (ISO)

rotenone (EXP,ISO)

selenium atom (ISO)

serpentine asbestos (ISO)

silicon dioxide (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tebufenpyrad (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

thifluzamide (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

topotecan (EXP)

trans-pinosylvin (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

troglitazone (ISO)

trovafloxacin (EXP)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

fibroblast proliferation (ISO)

meiosis I (ISO)

mitotic cell cycle phase transition (ISO)

regulation of transcription by RNA polymerase II (ISO)

Molecular Function

chromatin binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

small cell lung carcinoma pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:12714746	PMID:18625720

Genomics

Comparative Map Data

Cks2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	13,722,360 - 13,727,519 (-)	NCBI		GRCr8
mRatBN7.2	17	13,570,611 - 13,575,770 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	17	13,499,535 - 13,504,692 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	15,110,401 - 15,115,560 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	13,426,332 - 13,431,489 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	13,587,664 - 13,593,423 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	13,587,665 - 13,593,423 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	15,662,365 - 15,667,466 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	19,423,502 - 19,429,451 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	13,326,389 - 13,331,548 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

CKS2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	89,311,195 - 89,316,703 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	89,311,195 - 89,316,703 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	91,926,110 - 91,931,618 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	91,115,933 - 91,121,438 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	89,155,666 - 89,161,171	NCBI
Celera	9	62,508,275 - 62,513,777 (+)	NCBI		Celera
Cytogenetic Map	9	q22.2	NCBI
HuRef	9	61,759,015 - 61,764,519 (+)	NCBI		HuRef
CHM1_1	9	92,074,940 - 92,080,445 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	101,474,973 - 101,480,477 (+)	NCBI		T2T-CHM13v2.0

Cks2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	51,799,268 - 51,804,698 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	51,799,268 - 51,804,696 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	51,645,232 - 51,650,662 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	51,645,232 - 51,650,660 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	51,740,601 - 51,746,031 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	51,657,821 - 51,663,150 (+)	NCBI		MGSCv36	mm8
Celera	13	52,718,130 - 52,723,560 (+)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	26.12	NCBI

Cks2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955515	2,730,148 - 2,736,539 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955515	2,731,210 - 2,736,296 (-)	NCBI	ChiLan1.0	ChiLan1.0

CKS2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	50,144,540 - 50,150,040 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	50,146,928 - 50,152,428 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	60,401,063 - 60,406,507 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	88,447,199 - 88,452,643 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	88,447,197 - 88,452,644 (+)	Ensembl	panpan1.1		panPan2

CKS2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	96,928,690 - 96,934,154 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	96,880,369 - 96,933,862 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	97,391,498 - 97,396,939 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	97,540,504 - 97,545,952 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	97,540,727 - 97,545,660 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	97,168,293 - 97,173,739 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	96,887,451 - 96,892,883 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	97,645,843 - 97,651,291 (-)	NCBI		UU_Cfam_GSD_1.0

Cks2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	11,112,845 - 11,118,052 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936780	257,410 - 262,654 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936780	257,302 - 262,654 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CKS2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	904,809 - 910,289 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	904,762 - 910,292 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	959,086 - 964,616 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CKS2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	99,806,749 - 99,812,202 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	88,128,216 - 88,133,692 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cks2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	23,297,259 - 23,302,711 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624765	23,297,668 - 23,302,545 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cks2
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	24
Count of miRNA genes:	23
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000019234
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	17	4299130	21293263	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7979968	16317111	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	29	41	31	19	31	1	1	53	24	39	3	1
Low		14	16	10		10	7	8	21	11	2	8	7
Below cutoff								2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001126083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC162005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000019234 ⟹ ENSRNOP00000019234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	13,587,665 - 13,593,423 (-)	Ensembl

RefSeq Acc Id:

NM_001126083 ⟹ NP_001119555

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	13,722,360 - 13,727,519 (-)	NCBI
mRatBN7.2	17	13,570,611 - 13,575,770 (-)	NCBI
Rnor_6.0	17	13,587,664 - 13,593,423 (-)	NCBI
Rnor_5.0	17	15,662,365 - 15,667,466 (-)	NCBI
RGSC_v3.4	17	19,423,502 - 19,429,451 (-)	RGD
Celera	17	13,326,389 - 13,331,548 (-)	RGD

Sequence:

show sequence

GCCTGCGGTCGTTGGCCTCATTCGAGTCGTTGCCCCGGCCTTAGGCGGACGTGGAGCTCCTTGT
GCCCCGTTTCCTTGTCCCGGTTTTTTCCTTCGCACGCCAGCAGGATGGCCCACAAGCAGATCTA
CTACTCAGACAAGTACTTCGACGAGCACTACGAGTACCGGCATGTCATGTTACCCAGAGAACTT
TCTAAACAAGTACCCAAAACTCATCTGATGTCCGAAGAGGAGTGGAGGAGACTTGGTGTTCAAC
AGAGTCTAGGATGGGTTCATTACATGATCCATGAGCCAGAACCGCATATTCTTCTCTTTAGACG
GCCTCTTCCAAAAGAACAACAAAAATGAAGTACAGCTGGGATCATCTAATAATCTTTTTCAAAT
TTAATGTATATGTGTATATAAGGTAGTATTCAGTGAATACTTGAAAAATGTACAAATCTTTCAT
CCATACCTGTGCATGAGCTGTATTCTTCACAGCAACAGAGCTCGGTTAAATGCAACTGCAAGTA
GGGTTATTTTAAGTTGTTAAAGATAAATTTTCTTGTAGTTTTTTTCTTAATATAAATGCCTGTT
TTACTTTACCTGTTTTGTTAAATAAAGTTTGTATATTGCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001119555	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62005	(Get FASTA)	NCBI Sequence Viewer
	EDL98088	(Get FASTA)	NCBI Sequence Viewer
	EDL98089	(Get FASTA)	NCBI Sequence Viewer
	EDL98090	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001119555 ⟸ NM_001126083
- UniProtKB:	B1WC51 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP HILLFRRPLPKEQQK hide sequence

RefSeq Acc Id:

ENSRNOP00000019234 ⟸ ENSRNOT00000019234

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WC51-F1-model_v2	AlphaFold	B1WC51	1-79	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700339

Promoter ID:

EPDNEW_R10862

Type:

single initiation site

Name:

Cks2_1

Description:

CDC28 protein kinase regulatory subunit 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	13,593,404 - 13,593,464	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562047	AgrOrtholog
BioCyc Gene	G2FUF-10073	BioCyc
Ensembl Genes	ENSRNOG00000014130	Ensembl
Gene3D-CATH	3.30.170.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9089459	IMAGE-MGC_LOAD
InterPro	Cyclin-dep_kinase_reg-sub	UniProtKB/TrEMBL
	Cyclin-dep_kinase_reg-sub_sf	UniProtKB/TrEMBL
KEGG Report	rno:498709	UniProtKB/TrEMBL
MGC_CLONE	MGC:187863	IMAGE-MGC_LOAD
NCBI Gene	498709	ENTREZGENE
PANTHER	CYCLIN-DEPENDENT KINASES REGULATORY SUBUNIT 2	UniProtKB/TrEMBL
	CYCLIN-DEPENDENT KINASES REGULATORY SUBUNIT/60S RIBOSOME SUBUNIT BIOGENESIS PROTEIN NIP7	UniProtKB/TrEMBL
Pfam	CKS	UniProtKB/TrEMBL
PharmGKB	CKS2	RGD
PhenoGen	Cks2	PhenoGen
PRINTS	CYCLINKINASE	UniProtKB/TrEMBL
PROSITE	CKS_1	UniProtKB/TrEMBL
	CKS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014130	RatGTEx
SMART	CKS	UniProtKB/TrEMBL
Superfamily-SCOP	Cyc_dep_kin_rsub	UniProtKB/TrEMBL
UniProt	B1WC51	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Cks2	CDC28 protein kinase regulatory subunit 2	RGD1562047_predicted	similar to Cyclin-dependent kinases regulatory subunit 2 (CKS-2) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562047_predicted	similar to Cyclin-dependent kinases regulatory subunit 2 (CKS-2) (predicted)	LOC498709	similar to Cyclin-dependent kinases regulatory subunit 2 (CKS-2)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498709	similar to Cyclin-dependent kinases regulatory subunit 2 (CKS-2)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)