Gtpbp6 (GTP binding protein 6 (putative))

Gene: Gtpbp6 (GTP binding protein 6 (putative)) Rattus norvegicus

Analyze

Symbol:

Gtpbp6

Name:

GTP binding protein 6 (putative)

RGD ID:

1305954

Description:

Predicted to enable ribosome binding activity. Predicted to be active in cytoplasm. Orthologous to human GTPBP6 (GTP binding protein 6 (putative)); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC100912590; LOC363931; putative GTP-binding protein 6; putative GTP-binding protein 6-like; RGD1305954; similar to Pseudoautosomal GTP-binding protein-like protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTPBP6 (GTP binding protein 6 (putative))	HGNC	EggNOG, Ensembl, Inparanoid, OrthoDB, Panther
Mus musculus (house mouse):	Gtpbp6 (GTP binding protein 6 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtpbp6 (GTP binding protein 6 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100969322 (putative GTP-binding protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTPBP6 (GTP binding protein 6 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtpbp6 (GTP binding protein 6 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC110257936 (putative GTP-binding protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTPBP6 (GTP binding protein 6 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtpbp6 (GTP binding protein 6 (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GTPBP6 (GTP binding protein 6 (putative))	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gtpbp6 (GTP binding protein 6 (putative))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gtpbp6 (GTP binding protein 6 (putative))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F46B6.4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5116	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtpbp6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	52,234,646 - 52,238,578 (+)	NCBI		GRCr8
mRatBN7.2	12	46,574,913 - 46,578,873 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	46,574,435 - 46,578,873 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	47,751,181 - 47,755,040 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	48,356,580 - 48,360,439 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	47,417,104 - 47,420,963 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	52,637,000 - 52,640,869 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,637,000 - 52,640,839 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,670,898 - 52,674,737 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	54,373,897 - 54,377,766 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	46,722,131 - 46,726,000 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	46,589,062 - 46,592,902 (+)	NCBI
Celera	12	48,130,798 - 48,134,675 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

antimony(0) (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper(II) chloride (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

disodium selenite (ISO)

fenthion (ISO)

gentamycin (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

nickel sulfate (ISO)

ouabain (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

Theaflavin 3,3'-digallate (ISO)

toluene (EXP,ISO)

tributylstannane (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IBA)

Molecular Function

GTP binding (IEA)

metal ion binding (IEA)

ribosome binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Gtpbp6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	52,234,646 - 52,238,578 (+)	NCBI		GRCr8
mRatBN7.2	12	46,574,913 - 46,578,873 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	46,574,435 - 46,578,873 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	47,751,181 - 47,755,040 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	48,356,580 - 48,360,439 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	47,417,104 - 47,420,963 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	52,637,000 - 52,640,869 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,637,000 - 52,640,839 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	12	52,670,898 - 52,674,737 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	54,373,897 - 54,377,766 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	46,722,131 - 46,726,000 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	46,589,062 - 46,592,902 (+)	NCBI
Celera	12	48,130,798 - 48,134,675 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

GTPBP6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	Y	304,759 - 318,796 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38	X	304,759 - 318,796 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	Y	304,529 - 318,796 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38.p14 Ensembl	X	304,529 - 318,796 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	221,426 - 230,887 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
GRCh37	Y	171,426 - 180,887 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	161,426 - 170,887 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 36	Y	161,426 - 170,887 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	Y	161,425 - 170,887	NCBI
Celera	X	784,280 - 819,319 (+)	NCBI		Celera
Cytogenetic Map	X	;Y	NCBI
CHM1_1	X	204,984 - 214,451 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	132,988 - 149,851 (-)	NCBI		T2T-CHM13v2.0
T2T-CHM13v2.0	Y	132,137 - 148,937 (-)	NCBI		T2T-CHM13v2.0

Gtpbp6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	110,251,842 - 110,256,063 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	110,251,841 - 110,256,063 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	110,103,976 - 110,108,331 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	110,103,975 - 110,108,197 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	110,532,996 - 110,537,216 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	110,344,281 - 110,348,169 (-)	NCBI		MGSCv36	mm8
Celera	5	107,230,450 - 107,234,671 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	53.3	NCBI

Gtpbp6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955499	585,338 - 591,993 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100969322
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	112,976 - 126,173 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1-v2	Y	46,857,149 - 46,871,958 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	116,640 - 129,818 (-)	NCBI		NHGRI_mPanPan1
NHGRI_mPanPan1	Y	82,708 - 95,822 (-)	NCBI		NHGRI_mPanPan1

GTPBP6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	324,576 - 349,926 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	324,244 - 337,221 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	66,158 - 88,002 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	33,104 - 54,892 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	42,842 - 55,210 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	35,607 - 47,655 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	45,792 - 59,621 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	36,770 - 58,387 (-)	NCBI		UU_Cfam_GSD_1.0

Gtpbp6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404953	155,490 - 163,762 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936644	4,213,953 - 4,221,253 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC110257936
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	Y	6,985,633 - 6,999,844 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GTPBP6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666056	61,674 - 72,808 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtpbp6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624834	273,425 - 281,488 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624834	272,883 - 281,443 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gtpbp6
16 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	148
Count of miRNA genes:	93
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000056632, ENSRNOT00000063905
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat

Markers in Region

RH134558

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	46,578,686 - 46,578,868 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	52,674,581 - 52,674,762	NCBI	Rnor6.0
Rnor_6.0	12	52,640,683 - 52,640,864	NCBI	Rnor6.0
Rnor_5.0	12	54,410,591 - 54,410,772	UniSTS	Rnor5.0
Rnor_5.0	12	54,377,580 - 54,377,761	UniSTS	Rnor5.0
RGSC_v3.4	12	46,725,814 - 46,725,995	UniSTS	RGSC3.4
Celera	12	48,134,489 - 48,134,670	UniSTS
RH 3.4 Map	12	811.51	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	reproductive system
High
Medium
Low
Below cutoff	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000056632 ⟹ ENSRNOP00000053471

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	52,670,898 - 52,674,737 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000063905 ⟹ ENSRNOP00000059157

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	52,637,000 - 52,640,839 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105776 ⟹ ENSRNOP00000080925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	46,574,435 - 46,578,873 (+)	Ensembl

RefSeq Acc Id:

NM_001135840 ⟹ NP_001129312

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	52,234,709 - 52,238,578 (+)	NCBI
mRatBN7.2	12	46,575,004 - 46,578,873 (+)	NCBI
Rnor_6.0	12	52,637,000 - 52,640,869 (+)	NCBI
Rnor_5.0	12	54,373,897 - 54,377,766 (+)	NCBI
RGSC_v3.4	12	46,722,131 - 46,726,000 (+)	RGD
Celera	12	48,130,798 - 48,134,675 (+)	RGD

Sequence:

show sequence

ATGCTGTTCCCTCGCGTGGCCGCGCTCCCGGGCATCTGGCTCCTGCGTGTGAGGCGTGTCCAAC
ACGCTCTGAGCCTCGCGGGGACCCTGCCACGTCCCGTCCGCGCTGTCAGCGCCGGGAGCCGGGC
ACTGGGGAGCGTGTGGGCGTCAGACGGGCCCGTGCGAGGCGGAGGCCCGGAGGATCCACGTGAG
GACGAAGAGGAGGAGGAGTTGCTCCGTGTACCGCCCCTCCTGCCCTTTGACGCACAGCGCGTGT
GCGTCCTGCATCCTGACGTCAAACGCCCGGCCGGAAAAACGCCTCGCAGCACAGCGGAGTGGCA
GGTGGCAGAGGCAGCCGCGCTCGTGCGCGCGCTCCCGGGATGGTCGGTCGCGCGTACCCTGGTG
GTGTCCAGCGCAGCGCCTGGCAGCAGGCAGGTGTTCGGCAAGGGCAACTTCCGGGACCTGACAG
AGAAGATCAGGGGATGCCAGGATATCACATCGGTTTTCCTGAACGTGGAGAGGATGACGCCACA
GACCCAGAAGGAGCTGGAGACCGCGTGGGGCTTGCGCGTGTTCGACAGATTCACCTTGGTGCTT
CACATCTTCCGCTGCAACGCGCGCACCAGGGAGGCCAGGATGCAGCTGGCGCTGGCCGAGATTC
CGCTCCTCAGGTCCTCCGTGAGCGGGGACTCTGAGCAGCAGGATCAGCAAGGCTGGGGCTCCCG
GTACATCATGGGGTCAGGTGAGTCGTTCTCGGAACTGCGGGCGCGTGCACTCAGAGACCGGGAG
CTGCGGCTCCGCCGTGTCCTCGAGCGGCTGCGTGACAAGCGGAGGCTGATGCGGAAGGAGCGGG
TGCGGCGCGAGTTCCCCGTGGTGTCTGTGGTGGGGTACACCAACTGCGGGAAGACCACGCTCAT
CCGGGCTCTGACGGGCGAGGCCACTCTGCAGCCGCGGGACCAGCCATTCGCAACGCTCGACGTC
ACGGTGCACGAGGGGCGGCTGCCCTCGCGCCTTCGTGTCCTGTACGTGGACACCATTGGCTTCT
TGTCCCAGCTGCCGCACAGCCTGATCCACGCCTTCTCTGCCACGCTGGAGGATGTGGCCTACTC
GGACGTCCTGGTGCACGTGACCGATGTGAGCCATCCCGACGCAGAACTGCAGAAAGCCACGGTC
CTGTCCACACTGCGGGGCCTGGGTCTGCGCCCTGCACTGCTGGAGTCTGCCGTGGAGGTTCACA
GCAAGGTGGACCTGGTGCCTGGGCACACCACGCCATGCTCTGGAGCCCTGGCGGTATCTGCAGT
CTCAGGGCGTGGGCTGGACGAGCTGAAGGCGGCCCTGGAGGCGTCAGTGCTGCGCGCCACCGGC
AGGCAGCTGCTCACGATACGCGTGCGCCTCGGGGGACCCCAGCTTGGGTGGCTCTACAATGAGG
CCGTGGTGCAGCAGGTGCAGGAGCTTCCGGAGGGCGGTGCGGCCCACGTGACAGTCGTCATCAC
CCAGGCCGCCTATGGCCGGTTCCAGAAGCTGTTCCCCACTGACATCACTTCTGACCCCCACACT
GACTGACAGTTCATTAAAGCCGGTTGTGTTCCCCTT

hide sequence

RefSeq Acc Id:

XM_039089646 ⟹ XP_038945574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	52,234,646 - 52,236,657 (+)	NCBI
mRatBN7.2	12	46,574,913 - 46,576,978 (+)	NCBI

RefSeq Acc Id:

XM_039089647 ⟹ XP_038945575

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	52,234,646 - 52,236,657 (+)	NCBI
mRatBN7.2	12	46,574,913 - 46,576,978 (+)	NCBI

RefSeq Acc Id:

XM_063271566 ⟹ XP_063127636

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	52,234,646 - 52,237,383 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001129312	(Get FASTA)	NCBI Sequence Viewer
	XP_038945574	(Get FASTA)	NCBI Sequence Viewer
	XP_038945575	(Get FASTA)	NCBI Sequence Viewer
	XP_063127636	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14075	(Get FASTA)	NCBI Sequence Viewer
	EDM14076	(Get FASTA)	NCBI Sequence Viewer
	EDM14077	(Get FASTA)	NCBI Sequence Viewer
	EDM14078	(Get FASTA)	NCBI Sequence Viewer
	EDM14079	(Get FASTA)	NCBI Sequence Viewer
	EDM14080	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080925
	ENSRNOP00000080925.1

RefSeq Acc Id:

NP_001129312 ⟸ NM_001135840

- UniProtKB:

A0A8I5ZU18 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLFPRVAALPGIWLLRVRRVQHALSLAGTLPRPVRAVSAGSRALGSVWASDGPVRGGGPEDPRE
DEEEEELLRVPPLLPFDAQRVCVLHPDVKRPAGKTPRSTAEWQVAEAAALVRALPGWSVARTLV
VSSAAPGSRQVFGKGNFRDLTEKIRGCQDITSVFLNVERMTPQTQKELETAWGLRVFDRFTLVL
HIFRCNARTREARMQLALAEIPLLRSSVSGDSEQQDQQGWGSRYIMGSGESFSELRARALRDRE
LRLRRVLERLRDKRRLMRKERVRREFPVVSVVGYTNCGKTTLIRALTGEATLQPRDQPFATLDV
TVHEGRLPSRLRVLYVDTIGFLSQLPHSLIHAFSATLEDVAYSDVLVHVTDVSHPDAELQKATV
LSTLRGLGLRPALLESAVEVHSKVDLVPGHTTPCSGALAVSAVSGRGLDELKAALEASVLRATG
RQLLTIRVRLGGPQLGWLYNEAVVQQVQELPEGGAAHVTVVITQAAYGRFQKLFPTDITSDPHT
D

hide sequence

RefSeq Acc Id:

ENSRNOP00000059157 ⟸ ENSRNOT00000063905

RefSeq Acc Id:	XP_038945575 ⟸ XM_039089647
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038945574 ⟸ XM_039089646
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000053471 ⟸ ENSRNOT00000056632

RefSeq Acc Id:

ENSRNOP00000080925 ⟸ ENSRNOT00000105776

RefSeq Acc Id:	XP_063127636 ⟸ XM_063271566
- Peptide Label:	isoform X3

Protein Domains

Hflx-type G

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZLF0-F1-model_v2	AlphaFold	D3ZLF0	1-513	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305954	AgrOrtholog
BioCyc Gene	G2FUF-18797	BioCyc
Ensembl Genes	ENSRNOG00000037426	Ensembl
	ENSRNOG00000048168	Ensembl
	ENSRNOG00000062521	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000105776	ENTREZGENE
	ENSRNOT00000105776.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.11060	UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/TrEMBL
InterPro	G_HFLX_dom	UniProtKB/TrEMBL
	GTP-bd	UniProtKB/TrEMBL
	GTP-bd_M	UniProtKB/TrEMBL
	GTPase_HflX	UniProtKB/TrEMBL
	GTPase_HflX_N	UniProtKB/TrEMBL
	GTPase_HflX_N_sf	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
NCBI Gene	363931	ENTREZGENE
PANTHER	GTP-BINDING PROTEIN 6-RELATED	UniProtKB/TrEMBL
	PTHR10229	UniProtKB/TrEMBL
Pfam	GTP-bdg_M	UniProtKB/TrEMBL
	GTP-bdg_N	UniProtKB/TrEMBL
	MMR_HSR1	UniProtKB/TrEMBL
PhenoGen	Gtpbp6	PhenoGen
PROSITE	G_HFLX	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000037426	RatGTEx
	ENSRNOG00000048168	RatGTEx
	ENSRNOG00000062521	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I5ZU18	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gtpbp6	GTP binding protein 6 (putative)	LOC100912590	putative GTP-binding protein 6-like	Data merged from RGD:6486403	737654	PROVISIONAL
2012-07-05	LOC100912590	putative GTP-binding protein 6-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	Gtpbp6	GTP binding protein 6 (putative)	Gtpbp6_predicted	GTP binding protein 6 (putative) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Gtpbp6_predicted	GTP binding protein 6 (putative) (predicted)	RGD1305954_predicted	similar to Pseudoautosomal GTP-binding protein-like protein (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1305954_predicted	similar to Pseudoautosomal GTP-binding protein-like protein (predicted)	LOC363931_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC363931_predicted	similar to Pseudoautosomal GTP-binding protein-like protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar