ENCODES a protein that exhibits protein serine/threonine kinase activity; ubiquitin protein ligase binding; ATP binding (ortholog); INVOLVED IN cellular response to hydrogen sulfide; negative regulation of apoptotic process; negative regulation of gene expression; PARTICIPATES IN mitochondria dynamics pathway; altered mitochondrial autophagy pathway; mitochondrial autophagy pathway; ASSOCIATED WITH abnormal gait; abnormal motor coordination/balance; abnormal muscle tone; ASSOCIATED WITH Parkinson's Disease; Parkinsonian Disorders; Congenital Disorders of Glycosylation (ortholog); FOUND IN growth cone; mitochondrial inner membrane; mitochondrial intermembrane space; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene
3-(2,4-dichloro-5-methoxyphenyl)-2-sulfanyl-4(3H)-quinazolinone inhibits the reaction [arsenic trioxide results in increased expression of PINK1 protein]; more ...
3-(2,4-dichloro-5-methoxyphenyl)-2-sulfanyl-4(3H)-quinazolinone inhibits the reaction [arsenic trioxide results in increased expression of PINK1 protein]; more ...
MAVRQALGRGLQLGRALLLRFAPKPGPVSGWGKPGPGAAWGRGERPGRVSSPGAQPRPLGLPLP DRYRFFRQSVAGLAARIQRQFVVRARGGAGPCGRAVFLAFGLGLGLIEEKQAESRRAASACQEI QAIFTQKNKQVSDPLDTRRWQGFRLEDYLIGQAIGKGCNAAVYEATMPTLPQHLEKAKHLGLLG KGPDVVSKGADGEQAPGAPAFPFAIKMMWNISAGSSSEAILSKMSQELEALGSANRKGTLQQFR R
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
supported in part by the Cooperative Research Project Program of the Medical Institute of Bioregulation, Kyushu University, and the Genome Information Upgrading Program of the National BioResource Project, Japan Agency for Medical Research and Development
Gene-Chemical Interaction Annotations
