Gene: Gm32936 (predicted gene, 32936) Mus musculus |
|
Analyze |
|
Symbol: |
Gm32936 |
Name: |
predicted gene, 32936 |
RGD ID: |
9639837 |
MGI Page |
MGI |
Description: |
|
Type: |
protein-coding (Ensembl: processed_pseudogene)
|
RefSeq Status: |
MODEL |
Previously known as: |
6.8 kDa mitochondrial proteolipid-like; ATP synthase subunit ATP5MPL, mitochondrial-like |
Latest Assembly: |
GRCm39 - Mouse Genome Assembly GRCm39 |
Position: |
Mouse Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCm39 | 12 | 60,364,674 - 60,364,853 (+) | NCBI | GRCm39 | GRCm39 | mm39 | | GRCm39 Ensembl | 12 | 60,364,674 - 60,364,850 (+) | Ensembl | | GRCm39 Ensembl | | | GRCm38 | 12 | 60,317,888 - 60,318,067 (+) | NCBI | GRCm38 | GRCm38 | mm10 | GRCm38 | GRCm38.p6 Ensembl | 12 | 60,317,888 - 60,318,064 (+) | Ensembl | GRCm38 | | mm10 | GRCm38 | Celera | 12 | 61,469,198 - 61,469,377 (+) | NCBI | | Celera | | | Cytogenetic Map | 12 | C1 | NCBI | | | | |
|
JBrowse: |
View Region in Genome Browser (JBrowse)
|
Model |
|
References
Genomics
QTLs in Region (GRCm39)
4142234 | Tmc1m3_m | Tmc1 modifier 3 (mouse) | | | Not determined | | 12 | 5418440 | 77031203 | Mouse | 27226753 | Femd7_m | femur midshaft diameter 7, 10 week (mouse) | | | | | 12 | 9550000 | 84146774 | Mouse | 13207568 | Tcq14_m | total cholesterol QTL 14 (mouse) | | | | | 12 | 11660001 | 97176774 | Mouse | 1558978 | Cplaq10_m | circadian period of locomotor activity 10 (mouse) | | | Not determined | | 12 | 15341026 | 79040364 | Mouse | 1301574 | Lmblgq5_m | limb length QTL 5 (mouse) | | | Not determined | | 12 | 17596447 | 80956883 | Mouse | 1301989 | Hdlq18_m | HDL QTL 18 (mouse) | | | Not determined | | 12 | 29160685 | 63160884 | Mouse | 1300636 | Gct2_m | granulosa cell tumorigenesis 2 (mouse) | | | Not determined | | 12 | 29160685 | 63160884 | Mouse | 4141843 | Moen3_m | modifier of engrailed QTL 3 (mouse) | | | Not determined | | 12 | 29801584 | 63801733 | Mouse | 14747008 | Mancz10_m | mandible centroid size 10 (mouse) | | | | | 12 | 29863522 | 63863522 | Mouse | 10402492 | Dipa8_m | drug induced psychomotor activation 8 (mouse) | | | Not determined | | 12 | 34933872 | 68934019 | Mouse | 1300818 | Bbaa10_m | B.burgdorferi-associated arthritis 10 (mouse) | | | Not determined | | 12 | 35091004 | 65511019 | Mouse | 4142002 | Tbqt3_m | tibia bone quality traits 3 (mouse) | | | Not determined | | 12 | 35285496 | 109936243 | Mouse | 1357479 | Splwt1_m | spleen weight 1 (mouse) | | | Not determined | | 12 | 41693175 | 90887526 | Mouse | 1357757 | Lnopy2_m | lens opacity 2 (mouse) | | | Not determined | | 12 | 52846626 | 86846796 | Mouse | 1357749 | Vtbt13_m | vertebral trabecular bone trait 13 (mouse) | | | Not determined | | 12 | 53132002 | 87132145 | Mouse | 12832727 | Ahrq1_m | airway hyperresponsiveness QTL 1 (mouse) | | | | | 12 | 54695910 | 82665939 | Mouse | 13504832 | Bacszq2_m | baculum size QTL 2 (mouse) | | | | | 12 | 56945798 | 75345787 | Mouse | 27226728 | Tibl20_m | tibia length 20, 16 week (mouse) | | | | | 12 | 59146786 | 93866774 | Mouse | |
Expression
Sequence
RefSeq Acc Id: |
ENSMUST00000219590 |
Type: |
CODING |
Position: |
Mouse Assembly | Chr | Position (strand) | Source |
---|
GRCm39 Ensembl | 12 | 60,364,674 - 60,364,850 (+) | Ensembl | GRCm38.p6 Ensembl | 12 | 60,317,888 - 60,318,064 (+) | Ensembl |
|
RefSeq Acc Id: |
XM_006516450 ⟹ XP_006516513 |
Type: |
CODING |
Position: |
Mouse Assembly | Chr | Position (strand) | Source |
---|
GRCm39 | 12 | 60,364,674 - 60,364,853 (+) | NCBI | GRCm38 | 12 | 60,317,888 - 60,318,067 (+) | NCBI |
|
Sequence: |
ATGCTTCAATGTTTTAAGAATGTCTTGGTCCCTATGAAACCCTACTATACCCTGGTTTACCAGG AAATTTACGTAAGAATGAGGTTAATGACCCTCATCATTTATAAAATCAGGAATGCTGATAAAAG AAGAAAAGCTTTGAATGGCTCCAGTCGTTCACCTACCCATGTCAATCACTAA
hide sequence
|
RefSeq Acc Id: |
XP_006516513 ⟸ XM_006516450 |
- Sequence: |
MLQCFKNVLVPMKPYYTLVYQEIYVRMRLMTLIIYKIRNADKRRKALNGSSRSPTHVNH
hide sequence
|
Additional Information
|
|