Foxi3 (forkhead box I3) - Rat Genome Database

Name: Foxi3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Foxi3 (forkhead box I3) Mus musculus

Analyze

Symbol:

Foxi3

Name:

forkhead box I3

RGD ID:

9586081

MGI Page

MGI

Description:

Is expressed in several structures, including alimentary system; branchial arch; embryo ectoderm; integumental system; and sensory organ. Orthologous to human FOXI3 (forkhead box I3); INTERACTS WITH 4,4'-sulfonyldiphenol; bisphenol A; bisphenol F.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Also known as:

forkhead box protein I3

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXI3 (forkhead box I3)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, Panther
Rattus norvegicus (Norway rat):	Foxi3 (forkhead box I3)	HGNC	NCBI, OMA, HomoloGene, Inparanoid, Panther, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Foxi3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FOXI3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXI3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxi3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXI3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	FOXI3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxi3 (forkhead box I3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FOXI3 (forkhead box I3)	Alliance	DIOPT (HGNC\|PhylomeDB\|Roundup)
Danio rerio (zebrafish):	foxi3a (forkhead box I3a)	Alliance	DIOPT (ZFIN)
Danio rerio (zebrafish):	foxi3b (forkhead box I3b)	Alliance	DIOPT (ZFIN)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	70,933,590 - 70,938,050 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	70,933,515 - 70,938,050 (+)	Ensembl
GRCm38	6	70,956,606 - 70,961,066 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	70,956,531 - 70,961,066 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	70,906,600 - 70,911,060 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	70,886,038 - 70,890,642 (+)	NCBI			mm8
Celera	6	73,035,029 - 73,039,489 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

triclosan (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

cell differentiation (IBA)

regulation of transcription by RNA polymerase II (IBA)

Molecular Function

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal facial morphology (IAGP)

abnormal geniculate ganglion morphology (IAGP)

abnormal mandible morphology (IAGP)

abnormal maxilla morphology (IAGP)

abnormal Meckel's cartilage morphology (IAGP)

abnormal middle ear morphology (IAGP)

abnormal nervous system development (IAGP)

abnormal otic placode morphology (IAGP)

abnormal palatine bone morphology (IAGP)

abnormal pharyngeal pouch morphology (IAGP)

abnormal temporal bone squamous part morphology (IAGP)

abnormal trigeminal ganglion morphology (IAGP)

abnormal vestibulocochlear ganglion morphology (IAGP)

absent incus (IAGP)

absent inner ear (IAGP)

absent malleus (IAGP)

absent mouth (IAGP)

absent outer ear (IAGP)

absent pharyngeal arches (IAGP)

absent stapes (IAGP)

absent tympanic ring (IAGP)

absent vibrissae (IAGP)

absent zygomatic bone (IAGP)

cranioschisis (IAGP)

embryonic lethality during organogenesis, incomplete penetrance (IAGP)

increased cranial neural crest cell apoptosis (IAGP)

increased embryonic tissue cell apoptosis (IAGP)

neonatal lethality, complete penetrance (IAGP)

no abnormal phenotype detected (IAGP)

small face (IAGP)

syngnathia (IAGP)

References

References - curated


1.	RGD automated import pipeline
2.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12466851	PMID:15376323	PMID:16530750	PMID:18787161	PMID:20171206	PMID:21873635	PMID:23441037	PMID:24650709	PMID:26450968	PMID:26550799	PMID:26581094	PMID:26952977
PMID:26992132	PMID:31412026

Genomics

Comparative Map Data

Foxi3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	70,933,590 - 70,938,050 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	70,933,515 - 70,938,050 (+)	Ensembl
GRCm38	6	70,956,606 - 70,961,066 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	70,956,531 - 70,961,066 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	70,906,600 - 70,911,060 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	70,886,038 - 70,890,642 (+)	NCBI			mm8
Celera	6	73,035,029 - 73,039,489 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI

FOXI3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	2	88,446,787 - 88,452,693 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	2	88,446,787 - 88,452,693 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	2	88,746,306 - 88,752,211 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	88,520,284 - 88,539,630 (-)	NCBI	NCBI36		hg18	NCBI36
Celera	2	88,034,019 - 88,038,349 (+)	NCBI
Cytogenetic Map	2	p11.2	NCBI
HuRef	2	87,669,933 - 87,673,975 (-)	NCBI		HuRef
CHM1_1	2	88,677,039 - 88,681,361 (-)	NCBI		CHM1_1

Foxi3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	102,933,487 - 102,937,655 (+)	NCBI
Rnor_6.0 Ensembl	4	98,775,908 - 98,780,082 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	4	98,775,908 - 98,780,082 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	163,554,654 - 163,558,828 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	104,145,540 - 104,149,714 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
Celera	4	92,109,460 - 92,113,635 (+)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

Foxi3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955424	356,951 - 358,221 (+)	NCBI	ChiLan1.0	ChiLan1.0

FOXI3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	89,488,473 - 89,493,839 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	2A	87,578,732 - 87,585,111 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

FOXI3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	17	38,032,479 - 38,037,630 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	17	38,032,479 - 38,036,424 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Foxi3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936712	517,566 - 522,709 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXI3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	57,586,706 - 57,590,344 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	57,586,669 - 57,590,366 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	60,254,441 - 60,256,594 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXI3
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	18,310,904 - 18,317,115 (+)	NCBI
ChlSab1.1 Ensembl	14	18,312,661 - 18,317,033 (+)	Ensembl

Foxi3
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624749	16,033,754 - 16,041,679 (+)	NCBI

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	1	117500000	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139100000	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87426034	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96656149	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96656149	Mouse
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96656149	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96656149	Mouse
26884441	Sklq3_m	skull length QTL 3, 5 week (mouse)					6	7600000	80600000	Mouse
1357442	Dbts1_m	diabetes 1 (mouse)			Not determined		6	18234148	73387692	Mouse
10412213	Sxbq2_m	SGC/Knj cross B6 QTL 2 (mouse)			Not determined		6	19912686	71322775	Mouse
13208564	Bmiq7_m	body mass index QTL 7 (mouse)					6	25000000	80000000	Mouse
4141782	Mrdq5_m	modifier of retinal degeneration QTL 5 (mouse)			Not determined			32850650	78238974	Mouse
14746995	Manh60_m	mandible shape 60 (mouse)					6	37225677	71225677	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38669625	92607450	Mouse
1301326	Trbv4c2_m	T cell receptor beta variable 4 (mouse)			Not determined		6	40891296	71379171	Mouse
12880424	V25Dq4_m	vitamin D inactive form serum level QTL 4 (mouse)					6	41600000	75600000	Mouse
1301266	Lmr4_m	leishmaniasis resistance 4 (mouse)			Not determined		6	42116373	76116515	Mouse
11040600	Lmr4c_m	leishmaniasis resistance 4c (mouse)					6	42116373	76116515	Mouse
11040601	Lmr4a_m	leishmaniasis resistance 4a (mouse)					6	42116373	76116515	Mouse
11533915	Mts4_m	mammary tumor susceptibility 4 (mouse)					6	42116373	76116515	Mouse
12910785	Pwgrq16_m	post-weaning growth rate QTL 16 (mouse)					6	43826813	77811523	Mouse
12910798	Pwgrq5_m	pre-weaning growth rate QTL 5 (mouse)					6	43826813	77811523	Mouse
12910802	Pwbwq12_m	post-weaning body weight QTL 12 (mouse)					6	43826813	77811523	Mouse
12910807	Pwbwq11_m	post-weaning body weight QTL 11 (mouse)					6	43826813	77811523	Mouse
12910809	Pwbwq10_m	post-weaning body weight QTL 10 (mouse)					6	43826813	77811523	Mouse
12910820	Ogrq3_m	overall growth rate QTL 3 (mouse)					6	43826813	77811523	Mouse
10043885	Cia6c_m	collagen induced arthritis QTL 6c (mouse)			Not determined		6	44465871	71119467	Mouse
1300618	Pgia19_m	proteoglycan induced arthritis 19 (mouse)			Not determined		6	45314059	87426034	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45314059	128835032	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46935985	136423692	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48720000	125360000	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48720000	148450000	Mouse
4140983	Srilp_m	sleep response to influenza, light phase (mouse)			Not determined			48726556	75447710	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48726556	125356785	Mouse
1301254	Skts11_m	skin tumor susceptibility 11 (mouse)			Not determined		6	51179150	85179300	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52161713	116155267	Mouse
4141028	Mclr_m	methylcholanthrene lymphoma resistance (mouse)			Not determined			54373427	88379171	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56308211	90308211	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56308211	90308211	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58447583	92447710	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58540433	92540433	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60057680	94057799	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63484738	97484905	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66713869	100714031	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70425898	104426034	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70425898	104426034	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70425898	104426034	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	142
Count of miRNA genes:	65
Interacting mature miRNAs:	70
Transcripts:	ENSMUST00000069634, ENSMUST00000163089
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001101464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC155842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000069634 ⟹ ENSMUSP00000065664

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	70,956,606 - 70,961,066 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000163089 ⟹ ENSMUSP00000125380

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	70,956,531 - 70,961,063 (+)	Ensembl

RefSeq Acc Id:

NM_001101464 ⟹ NP_001094934

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	70,933,590 - 70,938,050 (+)	NCBI
GRCm38	6	70,956,606 - 70,961,066 (+)	NCBI
Celera	6	73,035,029 - 73,039,489 (+)	NCBI

Sequence:

show sequence

GACATGGCCCTGTATTGCGGCGACAACTTCGTATACTCGCAGCCCGCCGCCGCGCCTGGTGCGC
CCCCGACCTCCAGGGCACCCTATGGGCTGTCCGACTACGCCGCACCGCCCGCTGCAGCCGCCAA
CCCCTACCTGTGGCTCAATGGGCCCGGCGTGGGCGGCCCAGCCTCCGCTGCCAGCTACCTAGGG
GCCCCGCCGCCGCCTCCCGGAGCTGCGCCCGGACCCTTCCTGCAGCCTCCAGCCGCTCCGGGCA
CCTTCGCGGGCGCCCAGCGGGGCTTCGCGCAGCCCTCGGCGTCCGCACCCGCCTCGCCCGCCGG
CTCGGCAGCCCCTGGCGAGCTGGGCTGGCTGTCGATGGCCAGCCGCGAGGACCTGATGAAGATG
GTGCGACCACCCTACTCGTACTCGGCGCTCATCGCTATGGCCATCCAGAGCGCGCCTGAGCGCA
AACTCACCCTCAGCCACATTTACCAGTTCGTCGCCGATAACTTCCCTTTCTACCAGCGCAGCAA
GGCCGGCTGGCAGAACTCCATCCGCCACAACCTATCACTCAACGACTGCTTTAAGAAGGTGCCC
CGCGACGAGGACGACCCAGGGAAGGGTAATTACTGGACTCTGGATCCAAACTGTGAGAAAATGT
TCGACAACGGAAACTTCCGTCGGAAGCGAAGGCGCCGCGCGGAGGCCAGCAGTAACCTTACTGT
GCCTTCAGGGACATCAAAATCAGAAGGGCAGTCCTCAAGACTAAGAGTGAGTGGGAAGCTGGAA
GGAGACAGCCCCTCTTCTATCCTGAGGCCATCTCAGTCACCAGAGCCTCCAGAGGGCACCAAGA
GTACTGCCTCCTCTCCTGGAGCATCCACCCTCACCTCCACTCCGTGTCTCAACACTTTCCTCAG
CACCTTTAACACCTTAAATGTCAACTCCAGCAGCAGCATGGGCAACCAGCGAACCCTCCCAGGC
AGCCGTCGCCACCTAGGAGGGACCCAGCTGCCCTCCAGCACGTTCCCCAACACCTCCGTTCCAG
ACAGTTCTCCAGACTCCATGCAGCTGAGCACTGTGGGTGGAAGCAACCAGCTGTCTTCCTACTA
CAACCCTTTCTCTGGTGGCAGCAGTGGGGACCAGAGCAGCCCCTTCAGCAGCCCTTTCTACAAC
TTCAGCATGGTCAACAGCCTCATCTACCCCCGGGATGGCTCTGATATATAGACA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094934	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDK98929	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001094934 ⟸ NM_001101464

- UniProtKB:

D3Z120 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALYCGDNFVYSQPAAAPGAPPTSRAPYGLSDYAAPPAAAANPYLWLNGPGVGGPASAASYLGA
PPPPPGAAPGPFLQPPAAPGTFAGAQRGFAQPSASAPASPAGSAAPGELGWLSMASREDLMKMV
RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKVPR
DEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSEGQSSRLRVSGKLEG
DSPSSILRPSQSPEPPEGTKSTASSPGASTLTSTPCLNTFLSTFNTLNVNSSSSMGNQRTLPGS
RRHLGGTQLPSSTFPNTSVPDSSPDSMQLSTVGGSNQLSSYYNPFSGGSSGDQSSPFSSPFYNF
SMVNSLIYPRDGSDI

hide sequence

RefSeq Acc Id:

ENSMUSP00000125380 ⟸ ENSMUST00000163089

RefSeq Acc Id:

ENSMUSP00000065664 ⟸ ENSMUST00000069634

Protein Domains

Fork-head

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:3511278	AgrOrtholog
Ensembl Genes	ENSMUSG00000055874	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000065664	ENTREZGENE, UniProtKB/TrEMBL
	ENSMUSP00000125380	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000069634	ENTREZGENE, UniProtKB/TrEMBL
	ENSMUST00000163089	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
InterPro	TF_fork_head	UniProtKB/TrEMBL
	TF_fork_head_CS	UniProtKB/TrEMBL
	TF_fork_head_CS_2	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	mmu:232077	UniProtKB/TrEMBL
MGD	MGI:3511278	ENTREZGENE
NCBI Gene	Foxi3	ENTREZGENE
Pfam	Fork_head	UniProtKB/TrEMBL
PhenoGen	Foxi3	PhenoGen
PRINTS	FORKHEAD	UniProtKB/TrEMBL
PROSITE	FORK_HEAD_1	UniProtKB/TrEMBL
	FORK_HEAD_2	UniProtKB/TrEMBL
	FORK_HEAD_3	UniProtKB/TrEMBL
SMART	SM00339	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46785	UniProtKB/TrEMBL
UniProt	D3Z120	ENTREZGENE, UniProtKB/TrEMBL
	E0CZH3_MOUSE	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-05-18	Foxi3	forkhead box I3	Foxi3	forkhead box I3	Data Merged	737654	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)