Nppb (natriuretic peptide B) - Rat Genome Database

Name: Nppb
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Nppb (natriuretic peptide B) Chinchilla lanigera

Analyze

Symbol:

Nppb

Name:

natriuretic peptide B

RGD ID:

8816389

Description:

ENCODES a protein that exhibits hormone activity (ortholog); hormone receptor binding (ortholog); signaling receptor binding (ortholog); INVOLVED IN antimicrobial humoral immune response mediated by antimicrobial peptide (ortholog); cardiac muscle hypertrophy in response to stress (ortholog); cell growth involved in cardiac muscle cell development (ortholog); PARTICIPATES IN brain natriuretic peptide signaling pathway; ASSOCIATED WITH acute kidney failure (ortholog); adult respiratory distress syndrome (ortholog); Animal Disease Models (ortholog); FOUND IN extracellular space (ortholog); perinuclear region of cytoplasm (ortholog); protein-containing complex (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

natriuretic peptides B

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPPB (natriuretic peptide B)	NCBI	Ortholog
Mus musculus (house mouse):	Nppb (natriuretic peptide type B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Nppb (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NPPB (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPPB (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nppb (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPPB (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NPPB (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nppb (natriuretic peptide B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955486	2,054,775 - 2,056,130 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

adult respiratory distress syndrome (ISO)

Animal Disease Models (ISO)

anti-basement membrane glomerulonephritis (ISO)

aortic valve insufficiency (ISO)

atherosclerosis (ISO)

atrial fibrillation (ISO)

Brain Injuries (ISO)

Cardiomegaly (ISO)

cardiomyopathy (ISO)

Cardiotoxicity (ISO)

cardiovascular system disease (ISO)

Cerebral Hemorrhage (ISO)

Charcot-Marie-Tooth disease type 2 (ISO)

chromosome 1p36 deletion syndrome (ISO)

chronic kidney disease (ISO)

congenital heart disease (ISO)

congestive heart failure (ISO)

Contrast-Induced Nephropathy (ISO)

coronary artery disease (ISO)

COVID-19 (ISO)

Death (ISO)

diabetes mellitus (ISO)

Diabetic Nephropathies (ISO)

dilated cardiomyopathy (ISO)

Dyspnea (ISO)

Ehlers-Danlos syndrome kyphoscoliotic type 1 (ISO)

Eisenmenger Complex (ISO)

end stage renal disease (ISO)

essential hypertension (ISO)

Experimental Diabetes Mellitus (ISO)

Familial Atrial Fibrillation 6 (ISO)

genetic disease (ISO)

heart disease (ISO)

High Cardiac Output (ISO)

hyperhomocysteinemia (ISO)

hypertension (ISO)

hypertensive heart disease (ISO)

Hypertensive Nephropathy (ISO)

hypertrophic cardiomyopathy (ISO)

hypokalemia (ISO)

Hyponatremia (ISO)

Hypotension (ISO)

Inflammation (ISO)

Insulin Resistance (ISO)

Kawasaki disease (ISO)

Left Ventricular Hypertrophy (ISO)

liver cirrhosis (ISO)

Metabolic Side Effects of Drugs and Substances (ISO)

migraine (ISO)

morbid obesity (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (ISO)

nephrosis (ISO)

obesity (ISO)

Pain (ISO)

polycystic kidney disease (ISO)

Postoperative Complications (ISO)

proteinuria (ISO)

pulmonary embolism (ISO)

pulmonary hypertension (ISO)

renal hypertension (ISO)

sickle cell anemia (ISO)

systolic heart failure (ISO)

type 2 diabetes mellitus (ISO)

ureteral obstruction (ISO)

Vasovagal Syncope (ISO)

Ventricular Dysfunction, Left (ISO)

Ventricular Dysfunction, Right (ISO)

Ventricular Remodeling (ISO)

Ventricular Tachycardia (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

cardiac muscle hypertrophy in response to stress (ISO)

cell growth involved in cardiac muscle cell development (ISO)

cellular response to mechanical stimulus (ISO)

cGMP biosynthetic process (ISO)

coronary vasculature development (ISO)

endothelial cell proliferation (ISO)

heart development (ISO)

homeostasis of number of cells (ISO)

MAPK cascade (ISO)

negative regulation of cell growth (ISO)

negative regulation of cholangiocyte proliferation (ISO)

negative regulation of smooth muscle cell proliferation (ISO)

negative regulation of systemic arterial blood pressure (ISO)

positive regulation of cGMP-mediated signaling (ISO)

positive regulation of collecting lymphatic vessel constriction (ISO)

positive regulation of urine volume (ISO)

protein folding (ISO)

receptor guanylyl cyclase signaling pathway (ISO)

response to 3-methylcholanthrene (ISO)

response to calcium ion (ISO)

response to hypoxia (ISO)

response to lipopolysaccharide (ISO)

response to nutrient (ISO)

response to nutrient levels (ISO)

response to organic cyclic compound (ISO)

response to oxygen levels (ISO)

response to peptide hormone (ISO)

response to xenobiotic stimulus (ISO)

Cellular Component

extracellular space (ISO)

perinuclear region of cytoplasm (ISO)

protein-containing complex (ISO)

Molecular Function

hormone activity (ISO)

hormone receptor binding (ISO)

protein binding (ISO)

signaling receptor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

brain natriuretic peptide signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species

Additional References at PubMed

PMID:22301074	PMID:30032202

Genomics

Comparative Map Data

Nppb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955486	2,054,775 - 2,056,130 (+)	NCBI	ChiLan1.0	ChiLan1.0

NPPB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	11,857,464 - 11,858,945 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	11,857,464 - 11,858,945 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	11,917,521 - 11,919,002 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	11,840,108 - 11,841,579 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	11,851,789 - 11,853,254	NCBI
Celera	1	11,031,156 - 11,032,627 (-)	NCBI		Celera
Cytogenetic Map	1	p36.22	NCBI
HuRef	1	11,073,021 - 11,074,492 (-)	NCBI		HuRef
CHM1_1	1	11,905,417 - 11,906,888 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	11,401,560 - 11,403,041 (-)	NCBI		T2T-CHM13v2.0

Nppb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	148,070,264 - 148,071,662 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	148,070,245 - 148,071,662 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	147,985,786 - 147,987,205 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	147,985,788 - 147,987,205 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	147,359,898 - 147,361,314 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	146,829,697 - 146,830,998 (+)	NCBI		MGSCv36	mm8
Celera	4	150,250,201 - 150,251,617 (+)	NCBI		Celera
Cytogenetic Map	4	E1	NCBI
cM Map	4	78.57	NCBI

Nppb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	163,699,955 - 163,701,314 (+)	NCBI		GRCr8
mRatBN7.2	5	158,416,813 - 158,418,175 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	158,416,866 - 158,418,168 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	161,133,613 - 161,134,915 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	162,961,436 - 162,962,738 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	162,917,783 - 162,919,085 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	164,796,176 - 164,797,538 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	164,796,185 - 164,797,531 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	168,454,278 - 168,455,640 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	165,062,348 - 165,063,650 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	165,072,535 - 165,073,838 (+)	NCBI
Celera	5	156,698,873 - 156,700,175 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

NPPB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	216,361,604 - 216,364,862 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	215,008,742 - 215,011,988 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	10,621,416 - 10,622,960 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	11,838,518 - 11,839,999 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	11,838,518 - 11,839,995 (-)	Ensembl	panpan1.1		panPan2

NPPB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	84,395,844 - 84,397,473 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	80,929,289 - 80,930,932 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	85,060,368 - 85,062,010 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	85,060,271 - 85,073,309 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	81,809,597 - 81,811,239 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	82,809,514 - 82,811,156 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	83,872,280 - 83,873,924 (+)	NCBI		UU_Cfam_GSD_1.0

Nppb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	34,858,528 - 34,860,962 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	683,325 - 684,665 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	683,325 - 684,662 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPPB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	71,930,382 - 71,932,254 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	71,930,374 - 71,931,843 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	65,840,061 - 65,841,530 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPPB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	119,930,931 - 119,933,391 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	119,932,021 - 119,933,197 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	23,799,168 - 23,801,437 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nppb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624818	1,139,776 - 1,141,010 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_005403980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01058987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDJ01025595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

XM_005403980 ⟹ XP_005404037

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955486	2,054,775 - 2,056,130 (+)	NCBI

Sequence:

show sequence

AACCAGCCCCAAGATAAAAGGCTGAGTTGCAGAGGAGCCAGGAGAGCAGTGGGTAGAGAGAAGG
TGGGACAGGAGCTCAGGCAGCTAGGATTGTTTCAGCACCGGCCACCCTTCCTTCGATATGGGTC
CCCAGACAGCCCTGCCTCGCACGATTCTGCTCCTGCTTTTCCTGTACTTATCCGAGGGAGGTCG
ATCCCACCCTCTGGGCAGGCCCGACCAGGCTTCGGACCAATCGGGAATACAGGTCTCGGAGACA
CAGCCAGAGCACGTGACTCCGGAGCCACGCCAGCAGGGCAGATTGCCCACAGAAGCCTGGAAGG
CCAAGAAAGCAGCCCCCAAGAGCACCCTCCAGGCCTTTAGGGGAGTCCAAATGCCCAAGGTGAA
GCAAGATTCCAGTTGCTTTGGGAGGACAAGGATGGACCGGATCGATTCCGTCAGTGGCCTGGGC
TGCAAGGTGCTGAGGCGGCCTTAGGAAGAAGCCCAGGCTACAGACATCTGCTTCTGATACCACG
AGGGCTCCGACCCCAACCTCCTGACCTTCCTTGATTGACTCCTATTTATTAATTTATTTTGATT
TATATATTTGATTATTTTCTATAAGATGGCTTCTTACCTTTGAGCAAATACTTCCCACAATGAA
ATAAAATCAACAGTACAGCA

hide sequence

Protein Sequences


Protein RefSeqs	XP_005404037	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_005404037 ⟸ XM_005403980
- Sequence:	show sequence MGPQTALPRTILLLLFLYLSEGGRSHPLGRPDQASDQSGIQVSETQPEHVTPEPRQQGRLPTEA WKAKKAAPKSTLQAFRGVQMPKVKQDSSCFGRTRMDRIDSVSGLGCKVLRRP hide sequence

Additional Information

External Database Links

Database	Acc Id	Source(s)
NCBI Gene	Nppb	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations