Il1a (interleukin 1 alpha) - Rat Genome Database

Name: Il1a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Il1a (interleukin 1 alpha) Chinchilla lanigera

Analyze

Symbol:

Il1a

Name:

interleukin 1 alpha

RGD ID:

8794402

Description:

ENCODES a protein that exhibits copper ion binding (ortholog); cytokine activity (ortholog); interleukin-1 receptor binding (ortholog); INVOLVED IN acute inflammatory response (ortholog); cellular response to heat (ortholog); cellular sodium ion homeostasis (ortholog); PARTICIPATES IN interleukin-1 signaling pathway; ASSOCIATED WITH acute kidney failure (ortholog); acute myeloid leukemia (ortholog); allergic bronchopulmonary aspergillosis (ortholog); FOUND IN cell surface (ortholog); cytoplasm (ortholog); cytosol (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Also known as:

interleukin 1, alpha; interleukin-1 alpha

RGD Orthologs

Human

Mouse

Rat

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL1A (interleukin 1 alpha)	NCBI	Ortholog
Mus musculus (house mouse):	Il1a (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Il1a (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL1A (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL1A (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il1a (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL1A (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	IL1A (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il1a (interleukin 1 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	1,527,674 - 1,538,466 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	1,527,710 - 1,538,418 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

acute myeloid leukemia (ISO)

allergic bronchopulmonary aspergillosis (ISO)

allergic contact dermatitis (ISO)

Alzheimer's disease (ISO)

amnestic disorder (ISO)

Anorexia (ISO)

anthracosis (ISO)

Arsenic Poisoning (ISO)

aspiration pneumonia (ISO)

asthma (ISO)

autoimmune thrombocytopenic purpura (ISO)

B-Cell Chronic Lymphocytic Leukemia (ISO)

beta thalassemia (ISO)

Brain Injuries (ISO)

brain ischemia (ISO)

Burns (ISO)

Burns, Chemical (ISO)

cardiomyopathy (ISO)

Chemical and Drug Induced Liver Injury (ISO)

cholestasis (ISO)

cholesteatoma (ISO)

cholesteatoma of middle ear (ISO)

chorioamnionitis (ISO)

chronic progressive external ophthalmoplegia (ISO)

common cold (ISO)

corneal edema (ISO)

Craniocerebral Trauma (ISO)

Creutzfeldt-Jakob disease (ISO)

cystic fibrosis (ISO)

dermatomyositis (ISO)

diabetic retinopathy (ISO)

diarrhea (ISO)

Disease Progression (ISO)

Drug-Induced Immune Thrombocytopenia (ISO)

Drug-induced Neutropenia (ISO)

end stage renal disease (ISO)

endometritis (ISO)

Endotoxemia (ISO)

Enterocolitis (ISO)

Experimental Arthritis (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Leukemia (ISO)

Experimental Melanoma (ISO)

extrinsic allergic alveolitis (ISO)

Fabry disease (ISO)

Femoral Fractures (ISO)

Fetal Growth Retardation (ISO)

Fever (ISO)

glomerulonephritis (ISO)

Graft vs Host Disease (ISO)

Graves Ophthalmopathy (ISO)

head and neck squamous cell carcinoma (ISO)

Heat Stroke (ISO)

hemolytic-uremic syndrome (ISO)

Hemorrhage (ISO)

Hemorrhagic Shock (ISO)

HIV Wasting Syndrome (ISO)

Human Influenza (ISO)

Hyperalgesia (ISO)

hyperglycemia (ISO)

Hypotension (ISO)

IgA glomerulonephritis (ISO)

Inflammation (ISO)

interstitial lung disease (ISO)

Invasive Pulmonary Aspergillosis (ISO)

iridocyclitis (ISO)

juvenile rheumatoid arthritis (ISO)

Kearns-Sayre syndrome (ISO)

keratoconus (ISO)

Knee Osteoarthritis (ISO)

Leber hereditary optic neuropathy (ISO)

Liver Reperfusion Injury (ISO)

lung disease (ISO)

lung non-small cell carcinoma (ISO)

MELAS syndrome (ISO)

MERRF Syndrome (ISO)

mesenchymal chondrosarcoma (ISO)

Middle East respiratory syndrome (ISO)

mitochondrial myopathy (ISO)

multiple myeloma (ISO)

Myocardial Ischemia (ISO)

Myocardial Reperfusion Injury (ISO)

Nasal Polyps (ISO)

non-alcoholic fatty liver disease (ISO)

Oral Lichen Planus (ISO)

osteoarthritis (ISO)

osteoporosis (ISO)

otitis media (ISO)

pancreatic cancer (ISO)

Perennial Allergic Rhinitis (ISO)

periodontitis (ISO)

pneumonia (ISO)

Poisoning (ISO)

polymyositis (ISO)

pulmonary fibrosis (ISO)

pulmonary tuberculosis (ISO)

Radiation Injuries (ISO)

Radiation Pneumonitis (ISO)

Reperfusion Injury (ISO)

respiratory allergy (ISO)

Retina Reperfusion Injury (ISO)

rheumatoid arthritis (ISO)

Schnitzler syndrome (ISO)

Sclerosis (ISO)

severe acute respiratory syndrome (ISO)

skin disease (ISO)

Skin Neoplasms (ISO)

tick infestation (ISO)

type 1 diabetes mellitus (ISO)

urinary tract infection (ISO)

uveitis (ISO)

varicocele (ISO)

Venous Thrombosis (ISO)

vitiligo (ISO)

Wounds and Injuries (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acute inflammatory response (ISO)

cellular response to heat (ISO)

cellular sodium ion homeostasis (ISO)

connective tissue replacement involved in inflammatory response wound healing (ISO)

cytokine-mediated signaling pathway (ISO)

ectopic germ cell programmed cell death (ISO)

extrinsic apoptotic signaling pathway in absence of ligand (ISO)

heart development (ISO)

inflammatory response (ISO)

interleukin-1-mediated signaling pathway (ISO)

keratinization (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of establishment of Sertoli cell barrier (ISO)

positive regulation of angiogenesis (ISO)

positive regulation of cytokine production (ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

positive regulation of gene expression (ISO)

positive regulation of I-kappaB kinase/NF-kappaB signaling (ISO)

positive regulation of interleukin-2 production (ISO)

positive regulation of interleukin-6 production (ISO)

positive regulation of JNK cascade (ISO)

positive regulation of mitotic nuclear division (ISO)

positive regulation of monocyte chemotactic protein-1 production (ISO)

positive regulation of neutrophil extravasation (ISO)

positive regulation of neutrophil migration (ISO)

positive regulation of prostaglandin secretion (ISO)

positive regulation of protein secretion (ISO)

positive regulation of steroid biosynthetic process (ISO)

positive regulation of stress-activated MAPK cascade (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of tumor necrosis factor production (ISO)

positive regulation of vascular endothelial growth factor production (ISO)

regulation of actin cytoskeleton organization (ISO)

regulation of sensory perception of pain (ISO)

response to copper ion (ISO)

response to gamma radiation (ISO)

response to heat (ISO)

response to hypoxia (ISO)

response to L-ascorbic acid (ISO)

response to lipopolysaccharide (ISO)

response to organic cyclic compound (ISO)

response to organic substance (ISO)

response to organonitrogen compound (ISO)

response to ozone (ISO)

spermatogenesis (ISO)

wound healing (ISO)

Cellular Component

cell surface (ISO)

cytoplasm (ISO)

cytosol (ISO)

extracellular space (ISO)

plasma membrane (ISO)

Molecular Function

copper ion binding (ISO)

cytokine activity (ISO)

interleukin-1 receptor binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

interleukin-1 signaling pathway (ISO)

References

References - curated


1.	Automated assignment of GO, PW and RDO ISS annotations to Chinchilla, Squirrel, Bonobo and/or Dog genes from Human gene annotations

Genomics

Comparative Map Data

Il1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	1,527,674 - 1,538,466 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	1,527,710 - 1,538,418 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	2	112,773,925 - 112,784,493 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38.p13 Ensembl	2	112,773,915 - 112,784,590 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	2	112,773,925 - 112,784,493 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	2	113,531,492 - 113,542,971 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	113,247,963 - 113,259,442 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	2	113,247,723 - 113,259,202	NCBI
Celera	2	106,917,026 - 106,928,133 (-)	NCBI
Cytogenetic Map	2	q14.1	NCBI
HuRef	2	105,986,068 - 105,997,547 (-)	NCBI		HuRef
CHM1_1	2	113,535,646 - 113,546,810 (-)	NCBI		CHM1_1

Il1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	129,141,530 - 129,151,892 (-)	NCBI	GRCm39		mm39
GRCm38	2	129,299,609 - 129,310,186 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	129,299,610 - 129,309,972 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	129,125,346 - 129,135,708 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	2	128,991,051 - 129,001,413 (-)	NCBI			mm8
Celera	2	130,527,298 - 130,537,642 (-)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	62.9	NCBI

Il1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	3	121,824,712 - 121,836,122 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	121,825,412 - 121,836,086 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	128,180,475 - 128,190,980 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	116,913,612 - 116,924,114 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	3	116,819,184 - 116,829,687 (-)	NCBI
Celera	3	115,352,857 - 115,362,929 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

IL1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	113,784,854 - 113,795,801 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	113,784,854 - 113,795,801 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	89,273,482 - 89,284,421 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

IL1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	17	36,970,573 - 36,979,435 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	17	36,969,581 - 36,979,445 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Il1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936783	1,210,715 - 1,218,315 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	43,718,368 - 43,731,119 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	43,718,320 - 43,731,668 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	45,452,989 - 45,466,307 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	3	q12-q13	NCBI

IL1A
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	15,789,710 - 15,801,938 (-)	NCBI
ChlSab1.1 Ensembl	14	15,789,013 - 15,796,611 (-)	Ensembl

Il1a
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624749	12,795,967 - 12,805,658 (-)	NCBI

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_005400596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01052644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AGCD01052645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBDK01021553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSCLAT00000005998 ⟹ ENSCLAP00000005897

RefSeq Status:

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955470	1,527,674 - 1,538,466 (+)	Ensembl

RefSeq Acc Id:

ENSCLAT00000005999 ⟹ ENSCLAP00000005898

RefSeq Status:

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955470	1,527,674 - 1,538,466 (+)	Ensembl

RefSeq Acc Id:

XM_005400596 ⟹ XP_005400653

RefSeq Status:

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955470	1,527,710 - 1,538,418 (+)	NCBI

Sequence:

show sequence

GGCTTCAGTGTCAAAGCAGTGCAGGAGTCATTTCATTGGCACTTGAATCGGCAAAGAAGTCAAG
ATGGCCAAAGTTCCGAACCTGTTCGAAGACCTGAAGAGTTGTTACAGTGAAAATGAAGAATATG
CTTCTGCCCTTGACCATCTCTCTCTGGATCAGAAATCCTTCTATGACACAAGCTATGGCCCACT
TGACAAGAGCTGCCTGGATGAATGTGAATCTCTGAATATCAGTGAAACCTCAGAGGCATCCAAT
CTCACCTTCGAGGAGAATTTAGTAGTGGTGTCAACGTCAGCCCATGGGAAGGTTCTGAAGAAGA
GACGGGTGAATTTAAATCAGAACACCACTAGTGAAGATCTGGAAGCCGTCGACAGTGATCTGGA
GGAAGAAATCATCAAGCCACGGTCAGCACCTTACAGCCTCCAGAACGAGATGAGATTCAGATAT
CTGAAGATTCTCAAAAAGGAATTCGTCCTAACTGATTCCATTCATCAAAACATAATTCGAGACT
CGACAGGTCAACACCTCCGAGCTCGTGCAATAACAGATCTGAGCCATGAAGTGAAATTTGACAT
GGGTGGTTACATATCAGCAACAGATCAGAGTACAAACCCTGTGACTCTAAGAATCTCAAAAACC
CGTCTGTTTGTGTGTGCTCAGGAGGAAGACCAGCCAGTGTTGCTGAAGGAGATGCCTGAGACAC
CAAGAGTCATCACAGGTAATGACCTCAACCTGATCTTCTTCTGGGAAACTGAAAGAAGCCGTAA
TTTCTTCAGGTCAGCTGTCAATTCAGAGTTGTACCTTGCCACAAAGGTGAACAGTGAGGTGTTC
ATGGCCAAGGCACCAACCTATATGAAAGATTTTCTGATATCCTAAAACCAGCCTCAGCTCTGGA
GTCTGTTAGTCTGTATGTACCACGTACATGAAGAAGTCGATCTCTACTCTTACTCATTTGCTGA
GCATGTGCTGAGCCTTTGTAATTCTAAATGAATGTTTACCATCTTCGTAAGAGAAGGGAATATC
TAATAGAACCAACATGAACGTATAATGCTCTTTGTTATTTAAAGGACACCCTATACTTTGCACA
GTACCAATCATTTTAATTACCATTTTTCATAACATTCATAGAAGGACCAGGGCTACTGACAGCA
GTTCCCAAAAAGACTCTACTCATACTACAGGCAGGTTAACCAAGGCATAAGAAAACTAAAAAAT
ATACAAATAGCAGTTGGAATGACAAACCACAGGCCTAGGATTCCATTCCAACTTTGTGCCTTCT
GCTTCTAAATTACTGATAGACTCTTAGACAAATAGGGATAGTTTCTAGGATCTTAGTTTTACCA
TTTTCAAAAAGGGGAGAATGATACCTACGTCCTTCCTGCCTCCTTTTTTTGGTTTTGTTTTGTT
TTGTTTTATTTTTTTGGTACTGAGAATCAAACTCATGACCTTGGGCTTTCCAGGCAGGTGCTGT
GCTGCTGAGCTATATCCCCAAACCATCTGTTTTTTTTAATGTCAAATAGTAAGGCCATTTTAGT
CAAACAACTCTTGAAGCTGAGCCTCAAGAAGAAGACAGACCATGGAATGTTATTTTTAAGTTAT
TTATACAAGTATTTATAAATATATTTAAAATAATTATATTATTATTATTATATTTATGGCGGCT
CCTTGCATCCTCTAAGAGTGACCAGACATGCTCAACAATGGTAGAGTTTCTAGGCTGAGTAAGT
CAGATGAAGCACTCCAGAGCACTAGGTCCAAGTAGTGCCTTCTCTGTAGCCCTGAAGCTCTGTA
CTCTAGTACTTGGGAGCCCTATAATATGACAATAAATTTATATTAATTACTTTCTTTGAGATGA
TAACTGAAATCTATATTAATTACTTTGTTTGAGATGATAACTGATAATAACAAGAATGTTTCAT
TCTTGCCTTGTCATTCTTGAGTTATTCAACTTCATGCATAATTAAATTCAACTAACTAAAATGG
GAGGATTTTAACTTGGCAACCATGGGACCACTGTTATCTGAAATTTCTTTTCTGAAATGTAATC
ATCTCAATCAAAATTGAATAAAGCAACAAATTTGATTGGA

hide sequence

Protein Sequences


Protein RefSeqs	XP_005400653	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

XP_005400653 ⟸ XM_005400596

- Sequence:

show sequence

MAKVPNLFEDLKSCYSENEEYASALDHLSLDQKSFYDTSYGPLDKSCLDECESLNISETSEASN
LTFEENLVVVSTSAHGKVLKKRRVNLNQNTTSEDLEAVDSDLEEEIIKPRSAPYSLQNEMRFRY
LKILKKEFVLTDSIHQNIIRDSTGQHLRARAITDLSHEVKFDMGGYISATDQSTNPVTLRISKT
RLFVCAQEEDQPVLLKEMPETPRVITGNDLNLIFFWETERSRNFFRSAVNSELYLATKVNSEVF
MAKAPTYMKDFLIS

hide sequence

RefSeq Acc Id:

ENSCLAP00000005898 ⟸ ENSCLAT00000005999

RefSeq Acc Id:

ENSCLAP00000005897 ⟸ ENSCLAT00000005998

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000004178	Ensembl, ENTREZGENE
Ensembl Protein	ENSCLAP00000005898	ENTREZGENE
Ensembl Transcript	ENSCLAT00000005999	ENTREZGENE
NCBI Gene	Il1a	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-16	Il1a	interleukin 1 alpha		interleukin 1, alpha	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)