Cmc4 (C-X9-C motif containing 4) - Rat Genome Database

Name: Cmc4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Cmc4 (C-X9-C motif containing 4) Rattus norvegicus

Analyze

Symbol:

Cmc4

Name:

C-X9-C motif containing 4

RGD ID:

7647017

Description:

Predicted to be located in mitochondrion. Orthologous to human CMC4 (C-X9-C motif containing 4); INTERACTS WITH aflatoxin B1 (ortholog); benzo[a]pyrene (ortholog); bisphenol A (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cx9C motif-containing protein 4; cx9C motif-containing protein 4-like; LOC102546764

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CMC4 (C-X9-C motif containing 4)	HGNC	Ensembl, HomoloGene, NCBI
Mus musculus (house mouse):	Cmc4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cmc4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CMC4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CMC4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cmc4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CMC4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CMC4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cmc4 (C-X9-C motif containing 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LPAR6 (lysophosphatidic acid receptor 6)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CMC4 (C-X9-C motif containing 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cmc4 (C-X9-C motif containing 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cmc4 (C-x(9)-C motif containing 4 homolog (S. cerevisiae))	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG42381	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	CMC4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	139,382 - 147,037 (+)	NCBI		GRCr8
mRatBN7.2	18	125,308 - 132,163 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	125,227 - 132,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	137,523 - 143,916 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	925,364 - 931,757 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	139,432 - 145,825 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	407,517 - 414,110 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	408,219 - 410,098 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	453,285 - 459,145 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	18	119,279 - 125,719 (+)	NCBI		Celera
Cytogenetic Map	18	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adrenoleukodystrophy (ISO)

autistic disorder (ISO)

Barth syndrome (ISO)

cerebral creatine deficiency syndrome 1 (ISO)

dyskeratosis congenita (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

favism (ISO)

genetic disease (ISO)

immunodeficiency 33 (ISO)

megacolon (ISO)

paraplegia (ISO)

periventricular nodular heterotopia (ISO)

Splenomegaly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cyclosporin A (ISO)

methyl methanesulfonate (ISO)

N-methyl-4-phenylpyridinium (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial intermembrane space (IBA)

mitochondrion (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15632090

Genomics

Comparative Map Data

Cmc4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	139,382 - 147,037 (+)	NCBI		GRCr8
mRatBN7.2	18	125,308 - 132,163 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	125,227 - 132,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	137,523 - 143,916 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	925,364 - 931,757 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	139,432 - 145,825 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	407,517 - 414,110 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	408,219 - 410,098 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	453,285 - 459,145 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	18	119,279 - 125,719 (+)	NCBI		Celera
Cytogenetic Map	18	p13	NCBI

CMC4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	155,061,622 - 155,071,136 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	155,061,622 - 155,071,136 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	154,289,897 - 154,299,411 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Celera	X	154,448,614 - 154,458,264 (-)	NCBI		Celera
Cytogenetic Map	X	q28	NCBI
HuRef	X	142,835,131 - 142,844,484 (-)	NCBI		HuRef
CHM1_1	X	154,201,524 - 154,211,174 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	153,298,030 - 153,307,544 (-)	NCBI		T2T-CHM13v2.0

Cmc4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	74,448,452 - 74,460,190 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	74,448,452 - 74,460,190 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	75,404,846 - 75,416,584 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	75,404,846 - 75,416,584 (-)	Ensembl	GRCm38		mm10	GRCm38
Cytogenetic Map	X	A7.3	NCBI

Cmc4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955594	618,516 - 624,780 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955594	618,516 - 624,780 (+)	NCBI	ChiLan1.0	ChiLan1.0

CMC4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	155,039,550 - 155,048,971 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	155,038,400 - 155,052,579 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	144,540,603 - 144,550,152 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	154,379,475 - 154,388,932 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	154,379,485 - 154,388,932 (-)	Ensembl	panpan1.1		panPan2

CMC4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	123,071,076 - 123,080,799 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	108,064,456 - 108,074,186 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	126,198,629 - 126,208,364 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	126,198,634 - 126,208,364 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	121,946,517 - 121,956,248 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	124,468,959 - 124,478,687 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	124,189,658 - 124,199,387 (-)	NCBI		UU_Cfam_GSD_1.0

Cmc4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	119,964,268 - 119,982,416 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936927	320,833 - 341,021 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936927	317,417 - 341,016 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CMC4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	125,372,941 - 125,376,999 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	125,372,941 - 125,383,272 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	143,099,933 - 143,110,085 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CMC4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	129,348,831 - 129,358,601 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	129,349,054 - 129,351,326 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	67,326,930 - 67,336,667 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cmc4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624963	212,030 - 221,697 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624963	212,470 - 221,697 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cmc4
75 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552968	Pigfal19	Plasma insulin-like growth factor 1 level QTL 19	11.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	18	1	25758124	Rat
9590248	Scort10	Serum corticosterone level QTL 10	19.71	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	1	25758124	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	34	43	31	19	31	1	4	73	34	41	11	1
Low		9	14	10		10	7	7	1	1			7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001400848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006222498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006222499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000084138 ⟹ ENSRNOP00000072400

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	125,227 - 132,160 (+)	Ensembl
Rnor_6.0 Ensembl	18	408,219 - 410,098 (-)	Ensembl

RefSeq Acc Id:

NM_001400848 ⟹ NP_001387777

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	140,121 - 146,519 (+)	NCBI
mRatBN7.2	18	125,765 - 132,163 (+)	NCBI

RefSeq Acc Id:

XM_006254392 ⟹ XP_006254454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	143,308 - 147,037 (+)	NCBI
mRatBN7.2	18	128,721 - 132,163 (+)	NCBI
Rnor_6.0	18	407,517 - 411,234 (-)	NCBI
Rnor_5.0	18	453,285 - 459,145 (-)	NCBI

Sequence:

show sequence

GCTGCTCCTACAACTTCTGCCAGAAACCTGACCCGCTACACGGTTTCACTTCCGCTTCCTGGAA
CACGCGCGATTGTACTTCCGCTTCAAGTCTCTTGGACATGCCGCGGAAGGATCCGTGCCAGAAA
TACGCCTGTGAGTTGCAAAAGTGTTTACAAGCCAACAACTACTCGGAATCGAGGTGCCAGGCCG
CCCTCCAGGAACTGCCTCGGTGCTGCGCCCGGTTCCCCAAGGGGGTGTCGCCCGTGTGCGCGGG
ATGGGAGAAAGAAGAGGAAGAGAAGTCGGTCATGGGGTCCGGGTCCGAGTGAAGCGGTGTCCGG
ACATTCACTTCCACTTCCGGTTTCCCTCGGGCTTCATTTCCTATCCTTCCTTCAAGCCTGGTAG
CGGCTGAGGGCAAATTAATGTGTGGAGAATACATGTGTGTAATGTACGCAGAATAAATGTGTTC
AATGGAGAAGGATCCGCTAAAATAAACCTGCTTTACATTGAGTTCTGGGTCTGTTACTAAATGA
GTTTTAAGAGCCCACAAGATACAGAGGGTCATGAGTTGACAAAGCGCACACCACATGTGTAACA
TGTAAAGCGTACACAATTTATAAAGATTTACTTATATGAGTACACTGTGTCCCATGACACACGG
TTGTGAGCCACCACGTGGCTGCCAGGAATTGAACTCTGGACCTTCAGGCGAGCTGCCTGTGCTT
TACTGTCCCACCCTCTCAGCGCCTCCTCTGCACAAACACAAGTGCGGCCTGCGCGGACCTCAGG
GCAGACTCAGATTTTATTTCAGACGAGGGCGGGATCTGAGGCTTGACCACTCGTGATGACCACT
GCTCGTGATGACCTTTGAACCTCGAGAAGAACACAGGGGATCACAACGCAGATGGTGGACGCGG
TTATCAATCAACATGCGATGCACACAGGGGGAGGGGTTAACACACGGCACGTGCTCGGTGTTAA
AGGTCTGTTATTGGTTCTGTAATAAGGACGGTATATATATATATATA

hide sequence

RefSeq Acc Id:

XM_039097393 ⟹ XP_038953321

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	139,382 - 147,037 (+)	NCBI
mRatBN7.2	18	125,308 - 132,163 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001387777	(Get FASTA)	NCBI Sequence Viewer
	XP_006254454	(Get FASTA)	NCBI Sequence Viewer
	XP_038953321	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL86648	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072400.2

RefSeq Acc Id:	XP_006254454 ⟸ XM_006254392
- Peptide Label:	isoform X2
- UniProtKB:	A6KNC3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPRKDPCQKYACELQKCLQANNYSESRCQAALQELPRCCARFPKGVSPVCAGWEKEEEEKSVMG SGSE hide sequence

RefSeq Acc Id:

ENSRNOP00000072400 ⟸ ENSRNOT00000084138

RefSeq Acc Id:	XP_038953321 ⟸ XM_039097393
- Peptide Label:	isoform X1

RefSeq Acc Id:	NP_001387777 ⟸ NM_001400848
- UniProtKB:	A6KNC3 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K2W2-F1-model_v2	AlphaFold	A0A0G2K2W2	1-68	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:7647017	AgrOrtholog
BioCyc Gene	G2FUF-8443	BioCyc
Ensembl Genes	ENSRNOG00000056435	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000084138.2	UniProtKB/TrEMBL
Gene3D-CATH	CytochromE C oxidase copper chaperone	UniProtKB/TrEMBL
InterPro	Cys_alpha_HP_mot_SF	UniProtKB/TrEMBL
	MTCP1	UniProtKB/TrEMBL
KEGG Report	rno:102546764	UniProtKB/TrEMBL
NCBI Gene	LOC102546764	ENTREZGENE
PANTHER	CX9C MOTIF-CONTAINING PROTEIN 4	UniProtKB/TrEMBL
	PTHR15590	UniProtKB/TrEMBL
Pfam	MTCP1	UniProtKB/TrEMBL
PhenoGen	Cmc4	PhenoGen
PROSITE	CHCH	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000056435	RatGTEx
Superfamily-SCOP	SSF47072	UniProtKB/TrEMBL
UniProt	A0A0G2K2W2_RAT	UniProtKB/TrEMBL
	A6KNC3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-09-05	Cmc4	C-X9-C motif containing 4	LOC102546764	cx9C motif-containing protein 4-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-12-18	LOC102546764	cx9C motif-containing protein 4-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar