APOA4 (apolipoprotein A4) - Rat Genome Database

Name: APOA4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: APOA4 (apolipoprotein A4) Homo sapiens

Analyze

Symbol:

APOA4

Name:

apolipoprotein A4

RGD ID:

737553

HGNC Page

HGNC

Description:

Exhibits several functions, including cation binding activity; cholesterol transfer activity; and phosphatidylcholine-sterol O-acyltransferase activator activity. Involved in several processes, including lipid transport; positive regulation of lipid metabolic process; and protein-lipid complex subunit organization. Localizes to chylomicron; high-density lipoprotein particle; and very-low-density lipoprotein particle. Colocalizes with cell surface. Implicated in Alzheimer's disease; colitis; myocardial infarction; and ulcerative colitis. Biomarker of several diseases, including Huntington's disease; Leber hereditary optic neuropathy; autoimmune disease (multiple); eye disease (multiple); and intermediate coronary syndrome.

Type:

protein-coding

RefSeq Status:

REVIEWED

Also known as:

apo-AIV; apoA-IV; apolipoprotein A-IV; MGC142154; MGC142156

RGD Orthologs

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	11	116,820,700 - 116,823,304 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	11	116,820,700 - 116,823,304 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	11	116,691,418 - 116,694,011 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	116,196,628 - 116,199,221 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	11	116,196,628 - 116,199,162	NCBI
Celera	11	113,849,234 - 113,851,827 (-)	NCBI
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	112,623,690 - 112,626,283 (-)	NCBI		HuRef
CHM1_1	11	116,576,178 - 116,578,767 (-)	NCBI		CHM1_1

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (IAGP,ISO)

anemia (ISO)

atherosclerosis (EXP)

cardiovascular system disease (IEA,IEP)

chronic kidney disease (IEP)

Chronic Pancreatitis (IEP)

colitis (IDA)

Coronary Disease (IAGP)

Crohn's disease (IEP)

diabetic retinopathy (IEP)

Dwarfism (IAGP)

Experimental Arthritis (ISO)

Experimental Liver Cirrhosis (EXP)

Experimental Liver Neoplasms (EXP)

Familial Pancreatic Carcinoma (IEP)

glaucoma (IEP)

Graft vs Host Disease (IEP)

Guillain-Barre syndrome (IEP)

Huntington's disease (IEP)

Hyperlipoproteinemia Type II (EXP)

Hyperlipoproteinemias (IEP)

Hypertriglyceridemia (IMP)

Inflammation (ISO)

intermediate coronary syndrome (IEP)

Intervertebral Disc Displacement (IEP)

Leber hereditary optic neuropathy (IEP)

major depressive disorder (ISO)

myocardial infarction (IAGP,IEA)

neovascular inflammatory vitreoretinopathy (IEP)

obesity (IEA)

Peripheral Nerve Injuries (ISO)

peripheral nervous system disease (ISO)

polyneuropathy (IEP)

relapsing-remitting multiple sclerosis (IEP)

retinal detachment (IEP)

rheumatoid arthritis (IEP)

schizophrenia (EXP,IEP)

Seasonal Allergic Rhinitis (IEP)

ulcerative colitis (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (ISO)

1-nitropropane (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2,6-diaminotoluene (ISO)

2-acetamidofluorene (ISO)

2-nitro-p-phenylenediamine (ISO)

2-nitropropane (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-acetylaminofluorene (ISO)

4-nitro-1,2-phenylenediamine (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-propyl-2-thiouracil (ISO)

acetamide (ISO)

amiodarone (ISO)

amitriptyline (ISO)

arsane (EXP)

arsenic atom (EXP)

benzbromarone (ISO)

benzo[a]pyrene (EXP,ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (EXP)

carbon nanotube (ISO)

cefaloridine (ISO)

cerium trichloride (ISO)

chenodeoxycholic acid (EXP)

choline (ISO)

clofibrate (ISO)

clomipramine (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (EXP)

cyclosporin A (EXP)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dichloroacetic acid (ISO)

diclofenac (ISO)

dicrotophos (EXP)

doramapimod (ISO)

fenofibrate (ISO)

flavonoids (ISO)

fluconazole (ISO)

folic acid (ISO)

fructose (EXP)

fumonisin B1 (ISO)

furan (ISO)

gold atom (ISO)

gold(0) (ISO)

graphite (ISO)

high-density lipoprotein cholesterol (EXP)

hydrazine (ISO)

hydrogen peroxide (EXP)

imipramine (ISO)

isoniazide (ISO)

ketoconazole (ISO)

L-ethionine (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

lithocholic acid (ISO)

metacetamol (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (ISO)

N-nitrosomorpholine (ISO)

N-Nitrosopyrrolidine (EXP)

nefazodone (ISO)

nickel atom (EXP,ISO)

O-methyleugenol (EXP)

ochratoxin A (ISO)

octadecanoic acid (EXP)

olanzapine (EXP)

oleic acid (EXP)

omeprazole (ISO)

p-toluidine (ISO)

paracetamol (EXP,ISO)

perfluorobutanesulfonic acid (ISO)

perfluorobutyric acid (ISO)

perfluorododecanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorohexanoic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

perfluoroundecanoic acid (ISO)

permethrin (ISO)

phenformin (ISO)

phenobarbital (ISO)

phenytoin (ISO)

piperonyl butoxide (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

propiconazole (ISO)

quercetin (ISO)

resveratrol (ISO)

rifaximin (EXP)

rotenone (ISO)

simvastatin (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

streptozocin (ISO)

sulfasalazine (ISO)

tamoxifen (ISO)

taurocholic acid (ISO)

tebuconazole (EXP)

tetrachloromethane (ISO)

thioacetamide (ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (ISO)

triolein (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

urethane (EXP)

valdecoxib (ISO)

valproic acid (EXP,ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular protein metabolic process (TAS)

cholesterol biosynthetic process (IBA)

cholesterol efflux (IBA,IDA)

cholesterol homeostasis (IBA,IDA)

cholesterol metabolic process (IDA)

chylomicron assembly (TAS)

chylomicron remodeling (IC,TAS)

high-density lipoprotein particle assembly (IBA)

high-density lipoprotein particle remodeling (IC)

hydrogen peroxide catabolic process (IDA)

innate immune response in mucosa (IDA)

intermembrane lipid transfer (IEA)

leukocyte cell-cell adhesion (IDA)

lipid catabolic process (IDA)

lipid homeostasis (IDA)

lipid transport (IDA)

lipoprotein metabolic process (IBA)

negative regulation of plasma lipoprotein oxidation (IDA)

peripheral nervous system axon regeneration (ISO)

phosphatidylcholine metabolic process (IBA,IDA)

phospholipid efflux (IBA,IDA)

positive regulation of cholesterol esterification (IBA,IDA)

positive regulation of fatty acid biosynthetic process (IBA,IDA)

positive regulation of lipid biosynthetic process (IBA)

positive regulation of lipoprotein lipase activity (IBA,IDA)

positive regulation of triglyceride catabolic process (IBA,IDA)

protein-lipid complex assembly (IMP)

regulation of cholesterol transport (IDA)

regulation of intestinal cholesterol absorption (IBA)

removal of superoxide radicals (IDA)

response to lipid hydroperoxide (IDA)

response to stilbenoid (IEA)

response to triglyceride (ISO)

retinoid metabolic process (TAS)

reverse cholesterol transport (IBA,IDA)

triglyceride homeostasis (IBA)

very-low-density lipoprotein particle remodeling (IBA,IDA)

Cellular Component

blood microparticle (HDA)

cell surface (IDA)

chylomicron (IBA,IDA)

collagen-containing extracellular matrix (HDA)

cytosol (TAS)

early endosome (TAS)

endoplasmic reticulum lumen (TAS)

extracellular exosome (HDA)

extracellular region (HDA,NAS,TAS)

extracellular space (HDA,IDA)

high-density lipoprotein particle (IBA,IDA)

synapse (ISO)

very-low-density lipoprotein particle (IDA)

Molecular Function

antioxidant activity (IDA)

cholesterol binding (IBA)

cholesterol transfer activity (IDA)

copper ion binding (IDA)

identical protein binding (IPI)

lipid binding (IMP)

lipid transporter activity (TAS)

phosphatidylcholine binding (IBA,IDA)

phosphatidylcholine-sterol O-acyltransferase activator activity (IBA,IDA)

phospholipid binding (IBA)

protein binding (IPI)

protein homodimerization activity (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

altered lipoprotein metabolic pathway (TAS)

lipoprotein metabolic pathway (TAS)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Abnormal coronary artery morphology (IAGP)

Bloody diarrhea (IAGP)

Coronary artery stenosis (IAGP)

Dementia (IAGP)

Inflammation of the large intestine (IAGP)

Myocardial infarction (IAGP)

References

References - curated


1.	Bai H, etal., Eur J Clin Invest. 1996 Dec;26(12):1115-24.
2.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
3.	Bouhenni RA, etal., Exp Eye Res. 2011 Jan;92(1):67-75. Epub 2010 Nov 13.
4.	Boyles JK, etal., J Biol Chem. 1990 Oct 15;265(29):17805-15.
5.	Broedl UC, etal., Inflamm Bowel Dis. 2007 Apr;13(4):391-7.
6.	Carboni L, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2010 Aug 16;34(6):1037-48. Epub 2010 May 23.
7.	Corella D and Ordovas JM, Annu Rev Nutr. 2005;25:341-90.
8.	Csaszar A, etal., Neurosci Lett. 1997 Jul 25;230(3):151-4.
9.	Cui Y, etal., Am J Pathol. 2011 Mar;178(3):1298-308.
10.	D'Aguanno S, etal., J Neuroimmunol. 2008 Jan;193(1-2):156-60. Epub 2007 Dec 3.
11.	Domanski D, etal., J Proteomics. 2011 Nov 26.
12.	Ebrini I, etal., Electrophoresis. 2000 Jun;21(11):2170-9.
13.	GOA_HUMAN data from the GO Consortium
14.	Huang YC, etal., PLoS One. 2011 Jan 31;6(1):e15809.
15.	Ito Y, etal., Science. 1990 Aug 17;249(4970):790-3.
16.	Ji Y, etal., Dement Geriatr Cogn Disord. 1999 Nov-Dec;10(6):473-5.
17.	Jiang L, etal., Amino Acids. 2003 Jul;25(1):49-57.
18.	Kee F, etal., Atherosclerosis. 1999 Jul;145(1):187-95.
19.	Langner CA, etal., J Biol Chem. 1991 Jun 25;266(18):11955-64.
20.	Li TW, etal., Chin Med J (Engl). 2010 Mar 5;123(5):537-43.
21.	Liu XD, etal., Proteomics. 2006 Feb;6(3):1019-28.
22.	Luczak M, etal., Proteome Sci. 2011 May 13;9:25.
23.	Makino Y, etal., J Allergy Clin Immunol. 2010 Dec;126(6):1163-9.e5.
24.	McGuirk J, etal., J Hematol Oncol. 2009 Apr 20;2:17.
25.	Papassotiropoulos A, etal., J Clin Psychiatry. 2005 Jul;66(7):940-7.
26.	Quilliot D, etal., Metabolism. 2001 Sep;50(9):1019-24.
27.	Rewers M, etal., Diabetes. 1994 Dec;43(12):1485-9.
28.	RGD automated import pipeline for gene-chemical interactions
29.	RGD automated import pipeline for human HPO-to-gene-to-disease annotations
30.	Schonfeld G, etal., Metabolism. 1979 Oct;28(10):1001-10.
31.	Shitama T, etal., Proteomics Clin Appl. 2008 Sep;2(9):1265-1280.
32.	Tumani H, etal., J Neuroimmunol. 2009 Sep 29;214(1-2):109-12. Epub 2009 Jul 9.
33.	Tumani H, etal., Neurosci Lett. 2009 Mar 13;452(2):214-7. Epub 2009 Jan 29.
34.	Vowinkel T, etal., J Clin Invest. 2004 Jul;114(2):260-9.
35.	Wong WM, etal., Circ Res. 2003 May 16;92(9):969-75. Epub 2003 Apr 3.
36.	Yang YR, etal., Cell Mol Neurobiol. 2008 Aug;28(5):737-44. Epub 2008 Mar 15.
37.	Zervos EE, etal., J Surg Res. 2006 Oct;135(2):317-22. Epub 2006 Jun 30.

Additional References at PubMed

PMID:1349197	PMID:1487136	PMID:1677358	PMID:1737067	PMID:1935934	PMID:1973689	PMID:2065039	PMID:2216752	PMID:2307668	PMID:2331673	PMID:2351649	PMID:2930771
PMID:3036793	PMID:3080432	PMID:3095477	PMID:3095836	PMID:3611972	PMID:3755616	PMID:3931073	PMID:4345202	PMID:6706947	PMID:7728150	PMID:8688083	PMID:8956036
PMID:9988739	PMID:10069372	PMID:10391210	PMID:11108737	PMID:11162594	PMID:11181750	PMID:11254757	PMID:11472750	PMID:11583715	PMID:11592042	PMID:11841825	PMID:11940599
PMID:11941585	PMID:11952809	PMID:12082592	PMID:12116231	PMID:12121350	PMID:12220435	PMID:12417525	PMID:12477932	PMID:12495081	PMID:12556235	PMID:12664082	PMID:12691171
PMID:12692552	PMID:12697303	PMID:12777472	PMID:12860258	PMID:12962772	PMID:14718574	PMID:14751811	PMID:15108119	PMID:15174051	PMID:15175360	PMID:15252864	PMID:15258202
PMID:15304365	PMID:15311933	PMID:15359534	PMID:15488874	PMID:15489334	PMID:15559160	PMID:15649902	PMID:15721024	PMID:15764642	PMID:15806598	PMID:15823278	PMID:15864114
PMID:15868628	PMID:15910632	PMID:15928313	PMID:15962178	PMID:16030523	PMID:16105043	PMID:16120654	PMID:16159879	PMID:16321685	PMID:16326171	PMID:16338932	PMID:16602826
PMID:16651467	PMID:16710093	PMID:16763159	PMID:16770585	PMID:16781717	PMID:16788210	PMID:16929032	PMID:16945374	PMID:17130180	PMID:17154273	PMID:17261136	PMID:17378725
PMID:17457002	PMID:17654446	PMID:17712726	PMID:17825930	PMID:17855807	PMID:17964293	PMID:18029348	PMID:18193043	PMID:18193044	PMID:18430727	PMID:18513389	PMID:18636124
PMID:18660489	PMID:18664021	PMID:18676680	PMID:18678879	PMID:18789138	PMID:18948973	PMID:18996102	PMID:19057464	PMID:19060906	PMID:19060911	PMID:19074352	PMID:19131662
PMID:19166692	PMID:19170196	PMID:19263529	PMID:19336370	PMID:19336475	PMID:19336561	PMID:19403283	PMID:19433068	PMID:19592705	PMID:19625176	PMID:19689828	PMID:19692168
PMID:19701693	PMID:19732897	PMID:19878569	PMID:19913121	PMID:19948975	PMID:20031551	PMID:20117098	PMID:20139978	PMID:20164363	PMID:20430392	PMID:20551380	PMID:20554794
PMID:20602615	PMID:20609189	PMID:20628086	PMID:20674306	PMID:20686565	PMID:20714348	PMID:20864672	PMID:21127258	PMID:21324458	PMID:21378990	PMID:21407247	PMID:21712729
PMID:21767760	PMID:21873635	PMID:21909109	PMID:22286219	PMID:22516433	PMID:22528093	PMID:22579246	PMID:22916037	PMID:23096082	PMID:23132909	PMID:23288849	PMID:23338533
PMID:23376485	PMID:23505323	PMID:23533145	PMID:24211975	PMID:24311788	PMID:24386095	PMID:24425874	PMID:24598141	PMID:24606699	PMID:25463085	PMID:25733664	PMID:26186194
PMID:26397108	PMID:26485402	PMID:26491253	PMID:26556724	PMID:27068509	PMID:27262366	PMID:27344311	PMID:27412012	PMID:27559042	PMID:27622441	PMID:27870653	PMID:28246167
PMID:28514442	PMID:29025558	PMID:29317355	PMID:30097533	PMID:30190457	PMID:32296183	PMID:32814053

Genomics

Candidate Gene Status

APOA4 is a candidate Gene for QTL BW298_H

Comparative Map Data

APOA4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	11	116,820,700 - 116,823,304 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	11	116,820,700 - 116,823,304 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	11	116,691,418 - 116,694,011 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	116,196,628 - 116,199,221 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	11	116,196,628 - 116,199,162	NCBI
Celera	11	113,849,234 - 113,851,827 (-)	NCBI
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	112,623,690 - 112,626,283 (-)	NCBI		HuRef
CHM1_1	11	116,576,178 - 116,578,767 (-)	NCBI		CHM1_1

Apoa4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	46,152,142 - 46,154,756 (+)	NCBI	GRCm39		mm39
GRCm38	9	46,240,844 - 46,243,458 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	46,240,696 - 46,243,459 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	46,048,927 - 46,051,541 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	9	45,992,149 - 45,994,285 (+)	NCBI			mm8
Celera	9	43,529,774 - 43,532,388 (+)	NCBI		Celera
Cytogenetic Map	9	A5.2	NCBI
cM Map	9	25.36	NCBI

Apoa4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	8	50,536,983 - 50,539,371 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	50,537,009 - 50,539,376 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	49,163,055 - 49,165,333 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	49,233,142 - 49,233,431 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	8	49,245,005 - 49,245,297 (+)	NCBI
Celera	8	46,121,074 - 46,123,455 (+)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI
RH 3.4 Map	8	473.3	RGD

Apoa4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	18,155,801 - 18,160,701 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	18,158,095 - 18,160,636 (-)	NCBI	ChiLan1.0	ChiLan1.0

APOA4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	11	115,591,788 - 115,594,382 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	115,591,788 - 115,594,382 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	11	111,659,186 - 111,661,790 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

APOA4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	5	16,751,799 - 16,754,837 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	5	16,751,588 - 16,754,215 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Apoa4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936542	2,098,683 - 2,101,127 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

APOA4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	44,201,508 - 44,204,206 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	44,201,587 - 44,204,072 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	49,273,837 - 49,276,322 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

APOA4
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	108,186,627 - 108,190,508 (-)	NCBI
ChlSab1.1 Ensembl	1	108,186,921 - 108,189,698 (-)	Ensembl

Apoa4
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624784	12,237,329 - 12,240,013 (-)	NCBI

Position Markers

G44371

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,636 - 116,691,734	UniSTS	GRCh37
Build 36	11	116,196,846 - 116,196,944	RGD	NCBI36
Celera	11	113,849,452 - 113,849,550	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,908 - 112,624,006	UniSTS

GDB:185195

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,586 - 116,692,597	UniSTS	GRCh37
Build 36	11	116,196,796 - 116,197,807	RGD	NCBI36
Celera	11	113,849,402 - 113,850,413	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,858 - 112,624,869	UniSTS

GDB:187004

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,439 - 116,694,131	UniSTS	GRCh37
Build 36	11	116,198,649 - 116,199,341	RGD	NCBI36
Celera	11	113,851,255 - 113,851,947	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,711 - 112,626,403	UniSTS

GDB:555472

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,353 - 116,693,523	UniSTS	GRCh37
Build 36	11	116,198,563 - 116,198,733	RGD	NCBI36
Celera	11	113,851,169 - 113,851,339	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,625 - 112,625,795	UniSTS

ECD09091

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,333 - 116,693,970	UniSTS	GRCh37
Build 36	11	116,198,543 - 116,199,180	RGD	NCBI36
Celera	11	113,851,149 - 113,851,786	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,605 - 112,626,242	UniSTS

ECD09182

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,656 - 116,692,291	UniSTS	GRCh37
Build 36	11	116,196,866 - 116,197,501	RGD	NCBI36
Celera	11	113,849,472 - 113,850,107	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,928 - 112,624,563	UniSTS

ECD09878

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,978 - 116,694,595	UniSTS	GRCh37
Build 36	11	116,199,188 - 116,199,805	RGD	NCBI36
Celera	11	113,851,794 - 113,852,411	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,626,250 - 112,626,867	UniSTS

ECD12438

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,613 - 116,693,156	UniSTS	GRCh37
Build 36	11	116,197,823 - 116,198,366	RGD	NCBI36
Celera	11	113,850,429 - 113,850,972	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,624,885 - 112,625,428	UniSTS

ECD20167

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,239 - 116,691,533	UniSTS	GRCh37
Build 36	11	116,196,449 - 116,196,743	RGD	NCBI36
Celera	11	113,849,055 - 113,849,349	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,511 - 112,623,805	UniSTS

REN72989

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,694,658 - 116,694,892	UniSTS	GRCh37
Build 36	11	116,199,868 - 116,200,102	RGD	NCBI36
Celera	11	113,852,474 - 113,852,708	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,626,930 - 112,627,164	UniSTS

REN72990

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,694,390 - 116,694,637	UniSTS	GRCh37
Build 36	11	116,199,600 - 116,199,847	RGD	NCBI36
Celera	11	113,852,206 - 113,852,453	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,626,662 - 112,626,909	UniSTS

REN72991

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,694,156 - 116,694,409	UniSTS	GRCh37
Build 36	11	116,199,366 - 116,199,619	RGD	NCBI36
Celera	11	113,851,972 - 113,852,225	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,626,428 - 112,626,681	UniSTS

REN72992

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,944 - 116,694,174	UniSTS	GRCh37
Build 36	11	116,199,154 - 116,199,384	RGD	NCBI36
Celera	11	113,851,760 - 113,851,990	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,626,216 - 112,626,446	UniSTS

REN72993

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,695 - 116,693,922	UniSTS	GRCh37
Build 36	11	116,198,905 - 116,199,132	RGD	NCBI36
Celera	11	113,851,511 - 113,851,738	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,967 - 112,626,194	UniSTS

REN72994

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,433 - 116,693,675	UniSTS	GRCh37
Build 36	11	116,198,643 - 116,198,885	RGD	NCBI36
Celera	11	113,851,249 - 113,851,491	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,705 - 112,625,947	UniSTS

REN72995

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,219 - 116,693,452	UniSTS	GRCh37
Build 36	11	116,198,429 - 116,198,662	RGD	NCBI36
Celera	11	113,851,035 - 113,851,268	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,491 - 112,625,724	UniSTS

REN72996

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,970 - 116,693,197	UniSTS	GRCh37
Build 36	11	116,198,180 - 116,198,407	RGD	NCBI36
Celera	11	113,850,786 - 113,851,013	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,625,242 - 112,625,469	UniSTS

REN72997

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,703 - 116,692,968	UniSTS	GRCh37
Build 36	11	116,197,913 - 116,198,178	RGD	NCBI36
Celera	11	113,850,519 - 113,850,784	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,624,975 - 112,625,240	UniSTS

REN72998

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,466 - 116,692,718	UniSTS	GRCh37
Build 36	11	116,197,676 - 116,197,928	RGD	NCBI36
Celera	11	113,850,282 - 113,850,534	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,624,738 - 112,624,990	UniSTS

REN72999

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,261 - 116,692,485	UniSTS	GRCh37
Build 36	11	116,197,471 - 116,197,695	RGD	NCBI36
Celera	11	113,850,077 - 113,850,301	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,624,533 - 112,624,757	UniSTS

REN73000

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,032 - 116,692,268	UniSTS	GRCh37
Build 36	11	116,197,242 - 116,197,478	RGD	NCBI36
Celera	11	113,849,848 - 113,850,084	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,624,304 - 112,624,540	UniSTS

REN73001

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,739 - 116,692,013	UniSTS	GRCh37
Build 36	11	116,196,949 - 116,197,223	RGD	NCBI36
Celera	11	113,849,555 - 113,849,829	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,624,011 - 112,624,285	UniSTS

REN73002

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,510 - 116,691,758	UniSTS	GRCh37
Build 36	11	116,196,720 - 116,196,968	RGD	NCBI36
Celera	11	113,849,326 - 113,849,574	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,782 - 112,624,030	UniSTS

REN73003

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,293 - 116,691,526	UniSTS	GRCh37
Build 36	11	116,196,503 - 116,196,736	RGD	NCBI36
Celera	11	113,849,109 - 113,849,342	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,565 - 112,623,798	UniSTS

REN73004

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,069 - 116,691,312	UniSTS	GRCh37
Build 36	11	116,196,279 - 116,196,522	RGD	NCBI36
Celera	11	113,848,885 - 113,849,128	RGD
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,623,341 - 112,623,584	UniSTS

stSG601802

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,691,297 - 116,692,662	UniSTS	GRCh37
Build 36	11	116,196,507 - 116,197,872	RGD	NCBI36
Celera	11	113,849,113 - 113,850,478	RGD
HuRef	11	112,623,569 - 112,624,934	UniSTS

stSG601803

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,692,643 - 116,693,794	UniSTS	GRCh37
Build 36	11	116,197,853 - 116,199,004	RGD	NCBI36
Celera	11	113,850,459 - 113,851,610	RGD
HuRef	11	112,624,915 - 112,626,066	UniSTS

stSG601804

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	11	116,693,761 - 116,694,762	UniSTS	GRCh37
Build 36	11	116,198,971 - 116,199,972	RGD	NCBI36
Celera	11	113,851,577 - 113,852,578	RGD
HuRef	11	112,626,033 - 112,627,034	UniSTS

WI-19503

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	11	q23	UniSTS
HuRef	11	112,626,377 - 112,626,590	UniSTS
GeneMap99-GB4 RH Map	11	373.38	UniSTS
Whitehead-RH Map	11	513.9	UniSTS

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	241
Count of miRNA genes:	228
Interacting mature miRNAs:	236
Transcripts:	ENST00000357780
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

adipose tissue

appendage

High

Medium

247

245

Low

179

119

243

161

154

261

111

132

Below cutoff

1120

1499

731

452

1674

1048

1243

708

739

435

1188

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_012044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_000482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL531739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AP006216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY422950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY555191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC074764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC113594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC113596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J02758	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M10373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M13654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X13629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENST00000357780 ⟹ ENSP00000350425

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	11	116,820,700 - 116,823,304 (-)	Ensembl

RefSeq Acc Id:

NM_000482 ⟹ NP_000473

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	116,820,700 - 116,823,304 (-)	NCBI
GRCh37	11	116,691,418 - 116,694,011 (-)	ENTREZGENE
Build 36	11	116,196,628 - 116,199,221 (-)	NCBI Archive
HuRef	11	112,623,690 - 112,626,283 (-)	ENTREZGENE
CHM1_1	11	116,576,178 - 116,578,767 (-)	NCBI

Sequence:

show sequence

TGCAGCGCAGGTGAGCTCTCCTGAGGACCTCTCTGTCAGCTCCCCTGATTGTAGGGAGGATCCA
GTGTGGCAAGAAACTCCTCCAGCCCAGCAAGCAGCTCAGGATGTTCCTGAAGGCCGTGGTCCTG
ACCCTGGCCCTGGTGGCTGTCGCCGGAGCCAGGGCTGAGGTCAGTGCTGACCAGGTGGCCACGG
TGATGTGGGACTACTTCAGCCAGCTGAGCAACAATGCCAAGGAGGCCGTGGAACATCTCCAGAA
ATCTGAACTCACCCAGCAACTCAATGCCCTCTTCCAGGACAAACTTGGAGAAGTGAACACTTAC
GCAGGTGACCTGCAGAAGAAGCTGGTGCCCTTTGCCACCGAGCTGCATGAACGCCTGGCCAAGG
ACTCGGAGAAACTGAAGGAGGAGATTGGGAAGGAGCTGGAGGAGCTGAGGGCCCGGCTGCTGCC
CCATGCCAATGAGGTGAGCCAGAAGATCGGGGACAACCTGCGAGAGCTTCAGCAGCGCCTGGAG
CCCTACGCGGACCAGCTGCGCACCCAGGTCAGCACGCAGGCCGAGCAGCTGCGGCGCCAGCTGA
CCCCCTACGCACAGCGCATGGAGAGAGTGCTGCGGGAGAACGCCGACAGCCTGCAGGCCTCGCT
GAGGCCCCACGCCGACGAGCTCAAGGCCAAGATCGACCAGAACGTGGAGGAGCTCAAGGGACGC
CTTACGCCCTACGCTGACGAATTCAAAGTCAAGATTGACCAGACCGTGGAGGAGCTGCGCCGCA
GCCTGGCTCCCTATGCTCAGGACACGCAGGAGAAGCTCAACCACCAGCTTGAGGGCCTGACCTT
CCAGATGAAGAAGAACGCCGAGGAGCTCAAGGCCAGGATCTCGGCCAGTGCCGAGGAGCTGCGG
CAGAGGCTGGCGCCCTTGGCCGAGGACGTGCGTGGCAACCTGAGGGGCAACACCGAGGGGCTGC
AGAAGTCACTGGCAGAGCTGGGTGGGCACCTGGACCAGCAGGTGGAGGAGTTCCGACGCCGGGT
GGAGCCCTACGGGGAAAACTTCAACAAAGCCCTGGTGCAGCAGATGGAACAGCTCAGGCAGAAA
CTGGGCCCCCATGCGGGGGACGTGGAAGGCCACTTGAGCTTCCTGGAGAAGGACCTGAGGGACA
AGGTCAACTCCTTCTTCAGCACCTTCAAGGAGAAAGAGAGCCAGGACAAGACTCTCTCCCTCCC
TGAGCTGGAGCAACAGCAGGAACAGCAGCAGGAGCAGCAGCAGGAGCAGGTGCAGATGCTGGCC
CCTTTGGAGAGCTGAGCTGCCCCTGGTGCACTGGCCCCACCCTCGTGGACACCTGCCCTGCCCT
GCCACCTGTCTGTCTGTCTGTCCCAAAGAAGTTCTGGTATGAACTTGAGGACACATGTCCAGTG
GGAGGTGAGACCACCTCTCAATATTCAATAAAGCTGCTGAGAATCTAGCCTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_000473	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA51744	(Get FASTA)	NCBI Sequence Viewer
	AAA51745	(Get FASTA)	NCBI Sequence Viewer
	AAA51748	(Get FASTA)	NCBI Sequence Viewer
	AAA96731	(Get FASTA)	NCBI Sequence Viewer
	AAB59516	(Get FASTA)	NCBI Sequence Viewer
	AAH74764	(Get FASTA)	NCBI Sequence Viewer
	AAI13595	(Get FASTA)	NCBI Sequence Viewer
	AAI13597	(Get FASTA)	NCBI Sequence Viewer
	AAQ91809	(Get FASTA)	NCBI Sequence Viewer
	AAS68228	(Get FASTA)	NCBI Sequence Viewer
	CAA31955	(Get FASTA)	NCBI Sequence Viewer
	EAW67271	(Get FASTA)	NCBI Sequence Viewer
	P06727	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_000473 ⟸ NM_000482

- Peptide Label:

precursor

- Sequence:

show sequence

MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQD
KLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNL
RELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQ
NVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARI
SASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQ
QMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQ
QEQVQMLAPLES

hide sequence

RefSeq Acc Id:

ENSP00000350425 ⟸ ENST00000357780

Promoters

RGD ID:

7222215

Promoter ID:

EPDNEW_H16853

Type:

multiple initiation site

Name:

APOA4_1

Description:

apolipoprotein A4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	11	116,823,304 - 116,823,364	EPDNEW

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_000482.4(APOA4):c.1140G>T (p.Gln380His)	single nucleotide variant	APOLIPOPROTEIN A-IV POLYMORPHISM, APOA41/APOA42 [RCV000019494]	Chr11:116820918 [GRCh38] Chr11:116691634 [GRCh37] Chr11:11q23.3	pathogenic\|benign
APOLIPOPROTEIN A-IV RARE VARIANT, APOA4*0	insertion	APOLIPOPROTEIN A-IV RARE VARIANT, APOA4*0 [RCV000019495]	Chr11:11q23	pathogenic\|other
NM_000482.3(APOA4):c.748G>A (p.Glu250Lys)	single nucleotide variant	APOLIPOPROTEIN A-IV RARE VARIANT, APOA4*3 [RCV000019496]	Chr11:116821310 [GRCh38] Chr11:116692026 [GRCh37] Chr11:11q23.3	pathogenic\|other
APOLIPOPROTEIN A-IV RARE VARIANT, APOA4*5	insertion	APOLIPOPROTEIN A-IV RARE VARIANT, APOA4*5 [RCV000019497]	Chr11:11q23	pathogenic\|other
GRCh38/hg38 11q23.2-23.3(chr11:113444446-120648921)x3	copy number gain	See cases [RCV000050627]	Chr11:113444446..120648921 [GRCh38] Chr11:113315168..120519630 [GRCh37] Chr11:112820378..120024840 [NCBI36] Chr11:11q23.2-23.3	pathogenic
GRCh38/hg38 11q22.1-25(chr11:100348599-135040246)x3	copy number gain	See cases [RCV000053638]	Chr11:100348599..135040246 [GRCh38] Chr11:100219331..134910140 [GRCh37] Chr11:99724541..134415350 [NCBI36] Chr11:11q22.1-25	pathogenic
GRCh38/hg38 11q23.3(chr11:116436425-118046231)x3	copy number gain	See cases [RCV000053640]	Chr11:116436425..118046231 [GRCh38] Chr11:116307142..117916946 [GRCh37] Chr11:115812352..117422156 [NCBI36] Chr11:11q23.3	pathogenic
GRCh38/hg38 11q23.2-25(chr11:112864326-131189315)x3	copy number gain	See cases [RCV000137582]	Chr11:112864326..131189315 [GRCh38] Chr11:112832130..131059210 [GRCh37] Chr11:112240259..130564420 [NCBI36] Chr11:11q23.2-25	pathogenic
GRCh38/hg38 11q23.3(chr11:115647670-117581883)x3	copy number gain	See cases [RCV000137585]	Chr11:115647670..117581883 [GRCh38] Chr11:115518388..117452598 [GRCh37] Chr11:115023598..116957808 [NCBI36] Chr11:11q23.3	uncertain significance
GRCh38/hg38 11q23.3-25(chr11:116806268-135075271)x3	copy number gain	See cases [RCV000138307]	Chr11:116806268..135075271 [GRCh38] Chr11:116676984..134945165 [GRCh37] Chr11:116182194..134450377 [NCBI36] Chr11:11q23.3-25	pathogenic
GRCh38/hg38 11q23.3(chr11:116801587-116880319)x3	copy number gain	See cases [RCV000140064]	Chr11:116801587..116880319 [GRCh38] Chr11:116672303..116751035 [GRCh37] Chr11:116177513..116256245 [NCBI36] Chr11:11q23.3	uncertain significance
GRCh37/hg19 11q23.3-25(chr11:116691675-134889485)	copy number gain	not provided [RCV000767667]	Chr11:116691675..134889485 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3(chr11:115215434-120559928)x3	copy number gain	See cases [RCV000240308]	Chr11:115215434..120559928 [GRCh37] Chr11:11q23.3	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116681007-134938470)x3	copy number gain	See cases [RCV000449449]	Chr11:116681007..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116684163-134938470)x3	copy number gain	See cases [RCV000447848]	Chr11:116684163..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)	copy number gain	See cases [RCV000511729]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:230616-134938470)x3	copy number gain	See cases [RCV000510881]	Chr11:230616..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116681007-134938470)x3	copy number gain	See cases [RCV000512291]	Chr11:116681007..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3-25(chr11:116681007-134938470)x3	copy number gain	not provided [RCV000683373]	Chr11:116681007..134938470 [GRCh37] Chr11:11q23.3-25	pathogenic
GRCh37/hg19 11q23.3(chr11:116669751-120979377)x3	copy number gain	not provided [RCV000683365]	Chr11:116669751..120979377 [GRCh37] Chr11:11q23.3	likely pathogenic
GRCh37/hg19 11p15.5-q25(chr11:198510-134934063)x3	copy number gain	not provided [RCV000737348]	Chr11:198510..134934063 [GRCh37] Chr11:11p15.5-q25	pathogenic
GRCh37/hg19 11p15.5-q25(chr11:70864-134938470)x3	copy number gain	not provided [RCV000749874]	Chr11:70864..134938470 [GRCh37] Chr11:11p15.5-q25	pathogenic
NM_000482.4(APOA4):c.1057T>G (p.Ser353Ala)	single nucleotide variant	not provided [RCV000881516]	Chr11:116821001 [GRCh38] Chr11:116691717 [GRCh37] Chr11:11q23.3	benign
NM_000482.4(APOA4):c.1005C>T (p.Asp335=)	single nucleotide variant	not provided [RCV000942179]	Chr11:116821053 [GRCh38] Chr11:116691769 [GRCh37] Chr11:11q23.3	likely benign
NM_000482.4(APOA4):c.1008G>T (p.Val336=)	single nucleotide variant	not provided [RCV000971019]	Chr11:116821050 [GRCh38] Chr11:116691766 [GRCh37] Chr11:11q23.3	benign
NM_000482.4(APOA4):c.846C>T (p.Thr282=)	single nucleotide variant	not provided [RCV000974530]	Chr11:116821212 [GRCh38] Chr11:116691928 [GRCh37] Chr11:11q23.3	benign
NM_000482.4(APOA4):c.780C>T (p.Ala260=)	single nucleotide variant	not provided [RCV000974531]	Chr11:116821278 [GRCh38] Chr11:116691994 [GRCh37] Chr11:11q23.3	benign
Single allele	deletion	Short stature [RCV001003892]	Chr11:114433313..131230466 [GRCh37] Chr11:11q23.2-25	likely pathogenic

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:602	AgrOrtholog
COSMIC	APOA4	COSMIC
Ensembl Genes	ENSG00000110244	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSP00000350425	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000357780	ENTREZGENE, UniProtKB/Swiss-Prot
GTEx	ENSG00000110244	GTEx
HGNC ID	HGNC:602	ENTREZGENE
Human Proteome Map	APOA4	Human Proteome Map
InterPro	ApoA_E	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	337	ENTREZGENE
OMIM	107690	OMIM
Pfam	Apolipoprotein	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	APOA4	RGD, PharmGKB
UniGene	Hs.1247	ENTREZGENE
UniProt	APOA4_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q13784_HUMAN	UniProtKB/TrEMBL
UniProt Secondary	A8MSL6	UniProtKB/Swiss-Prot
	Q14CW8	UniProtKB/Swiss-Prot
	Q6Q787	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-03	APOA4	apolipoprotein A4		apolipoprotein A-IV	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

RGD Manual Annotations