FGA (fibrinogen alpha chain) - Rat Genome Database

Name: FGA
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: FGA (fibrinogen alpha chain) Homo sapiens

Analyze

Symbol:

FGA

Name:

fibrinogen alpha chain

RGD ID:

737209

HGNC Page

HGNC:3661

Description:

Enables structural molecule activity. Contributes to cell adhesion molecule binding activity and signaling receptor binding activity. Involved in several processes, including blood coagulation; negative regulation of apoptotic process; and positive regulation of secretion by cell. Located in several cellular components, including endoplasmic reticulum; external side of plasma membrane; and platelet alpha granule. Part of fibrinogen complex. Implicated in brain small vessel disease; congenital afibrinogenemia; familial visceral amyloidosis; and thrombophilia. Biomarker of Crohn's disease; acute lymphoblastic leukemia; keratoconus; and type 2 diabetes mellitus.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

Fib2; fibrinogen, A alpha polypeptide; fibrinogen, alpha polypeptide; MGC119422; MGC119423; MGC119425

RGD Orthologs

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Fga (fibrinogen alpha chain)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Fga (fibrinogen alpha chain)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Fga (fibrinogen alpha chain)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	FGA (fibrinogen alpha chain)	NCBI	Ortholog
Canis lupus familiaris (dog):	FGA (fibrinogen alpha chain)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fga (fibrinogen alpha chain)	NCBI	Ortholog
Sus scrofa (pig):	FGA (fibrinogen alpha chain)	HGNC	EggNOG, NCBI, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	FGA (fibrinogen alpha chain)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Fga (fibrinogen alpha chain)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Fga (fibrinogen alpha chain)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fga (fibrinogen alpha chain)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fga (fibrinogen alpha chain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid\|ZFIN)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	154,583,126 - 154,590,742 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	154,583,128 - 154,590,745 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	155,504,278 - 155,511,894 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	155,723,730 - 155,731,347 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	4	155,864,033 - 155,869,470	NCBI
Celera	4	152,835,246 - 152,842,862 (-)	NCBI
Cytogenetic Map	4	q31.3	NCBI
HuRef	4	151,244,861 - 151,252,473 (-)	NCBI		HuRef
CHM1_1	4	155,482,201 - 155,489,817 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	157,914,895 - 157,922,551 (-)	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

Acute Liver Failure (ISO)

Acute Lung Injury (ISO)

acute lymphoblastic leukemia (IEP)

acute pancreatitis (ISO)

asthma (ISO)

brain ischemia (ISO)

brain small vessel disease (IAGP,IEA)

Burns (ISO)

Chemical and Drug Induced Liver Injury (EXP)

cholestasis (EXP)

congenital afibrinogenemia (EXP,IAGP)

Congenital Dysfibrinogenemia (IAGP)

Congenital Hypodysfibrinogenemia (IAGP)

Crohn's disease (IEP)

disseminated intravascular coagulation (ISO)

Endotoxemia (ISO)

Experimental Diabetes Mellitus (ISO)

Familial Amyloidosis (EXP,IAGP)

familial visceral amyloidosis (IAGP)

hemorrhagic disease (IAGP)

keratoconus (IEP)

kidney disease (EXP)

Kidney Reperfusion Injury (ISO)

Liver Reperfusion Injury (ISO)

Mouth Neoplasms (EXP)

osteoporosis (EXP)

pancreatitis (ISO)

pulmonary embolism (EXP,ISO)

pulmonary emphysema (ISO)

Seasonal Allergic Rhinitis (IDA)

Sepsis (ISO)

Stroke (EXP)

thrombocytopenia (IAGP,ISO)

thrombophilia (EXP,IAGP)

thrombosis (EXP)

type 2 diabetes mellitus (IEP)

Venous Thromboembolism (EXP,IAGP)

Venous Thrombosis (IAGP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP,ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-14,16-dimethyloctadecan-3-ol (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (ISO)

acetamide (ISO)

acetylsalicylic acid (EXP)

ADP (EXP)

aflatoxin B1 (EXP)

ammonium chloride (ISO)

arachidonyl-2'-chloroethylamide (ISO)

arsane (EXP)

arsenic atom (EXP)

Azaspiracid (EXP)

azathioprine (EXP)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (EXP)

benzo[b]fluoranthene (EXP)

bexarotene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (ISO)

buta-1,3-diene (ISO)

butanal (EXP)

carbon nanotube (ISO)

CGP 52608 (EXP)

chloroform (ISO)

chlorpromazine (EXP)

choline (ISO)

cisplatin (EXP)

clofibric acid (ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (EXP)

cycloheximide (ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (EXP,ISO)

dabigatran (ISO)

decabromodiphenyl ether (ISO)

dibenz[a,h]anthracene (EXP)

dicrotophos (EXP)

dienogest (EXP)

diisopropyl fluorophosphate (ISO)

doxorubicin (ISO)

endosulfan (ISO)

erythromycin estolate (ISO)

fenofibrate (ISO)

flutamide (ISO)

folic acid (EXP,ISO)

furan (ISO)

genistein (ISO)

gestodene (EXP)

glafenine (ISO)

GW 4064 (ISO)

heparin (EXP)

hydrazine (ISO)

L-methionine (ISO)

lead diacetate (ISO)

levonorgestrel (EXP)

lipopolysaccharide (ISO)

methapyrilene (ISO)

methidathion (ISO)

methimazole (ISO)

methotrexate (ISO)

methylmercury chloride (EXP)

morphine (ISO)

N-nitrosodiethylamine (ISO)

natamycin (ISO)

nefazodone (ISO)

nickel atom (EXP)

nimesulide (ISO)

nitrofen (ISO)

norethisterone (EXP)

norgestimate (EXP)

nystatin (ISO)

O-methyleugenol (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

pentanal (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (EXP)

propanal (EXP)

quercetin (EXP)

quinidine (ISO)

rotenone (ISO)

silicon dioxide (EXP,ISO)

silver atom (EXP)

silver(0) (EXP)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (ISO)

sulfasalazine (ISO)

tacrolimus hydrate (ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

theophylline (ISO)

tolcapone (ISO)

tremolite asbestos (ISO)

tributylstannane (ISO)

Triptolide (ISO)

trovafloxacin (ISO)

urethane (EXP)

valproic acid (EXP)

vancomycin (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acute-phase response (ISO)

adaptive immune response (IEA)

blood coagulation (IEA,ISO)

blood coagulation, common pathway (IBA,IMP)

blood coagulation, fibrin clot formation (IDA)

cell-matrix adhesion (IDA)

cellular response to granulocyte colony-stimulating factor (ISO)

cellular response to interleukin-6 (ISO)

cellular response to organic cyclic compound (ISO)

envenomation resulting in modulation of blood coagulation in another organism (ISO)

fibrinolysis (IBA,IDA)

hemostasis (IEA)

immune system process (IEA)

induction of bacterial agglutination (IDA)

innate immune response (IEA)

liver regeneration (ISO)

negative regulation of blood coagulation, common pathway (TAS)

negative regulation of endothelial cell apoptotic process (IBA,IDA)

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors (IBA,IDA)

plasminogen activation (IDA)

platelet activation (IEA)

platelet aggregation (HMP,IBA,IDA)

positive regulation of ERK1 and ERK2 cascade (IBA,IDA)

positive regulation of exocytosis (IDA)

positive regulation of heterotypic cell-cell adhesion (IBA,IDA)

positive regulation of peptide hormone secretion (IBA,IDA)

positive regulation of protein secretion (IDA)

positive regulation of smooth muscle cell migration (ISO)

positive regulation of substrate adhesion-dependent cell spreading (NAS)

positive regulation of vasoconstriction (IDA)

protein polymerization (IBA,IDA,IEA)

protein-containing complex assembly (IDA,IMP)

response to calcium ion (IDA)

response to cycloheximide (ISO)

response to estradiol (ISO)

response to genistein (ISO)

response to growth hormone (ISO)

response to insulin (ISO)

response to morphine (ISO)

response to thyroid hormone (ISO)

response to toxic substance (ISO)

response to X-ray (ISO)

Cellular Component

blood microparticle (HDA,ISO)

cell cortex (ISO)

cell surface (IDA)

cellular anatomical entity (IEA)

collagen-containing extracellular matrix (HDA)

cytoplasm (ISO)

endoplasmic reticulum (IDA)

endoplasmic reticulum lumen (TAS)

external side of plasma membrane (IDA)

extracellular exosome (HDA)

extracellular region (IEA,NAS,TAS)

extracellular space (IDA,ISO)

extracellular vesicle (HDA)

fibrinogen complex (IBA,IDA,IEA,IPI,TAS)

plasma membrane (TAS)

platelet alpha granule (IDA)

platelet alpha granule lumen (TAS)

rough endoplasmic reticulum (ISO)

synapse (ISO)

Molecular Function

cell adhesion molecule binding (IDA)

extracellular matrix structural constituent (HDA,RCA)

metal ion binding (IEA)

protein binding (IPI)

signaling receptor binding (IDA,IEA)

structural molecule activity (IDA,IMP)

Molecular Pathway Annotations Click to see Annotation Detail View

acenocoumarol pharmacodynamics pathway (EXP)

alteplase pharmacodynamics pathway (EXP)

aminocaproic acid pharmacodynamics pathway (EXP)

anistreplase pharmacodynamics pathway (EXP)

aprotinin pharmacodynamics pathway (EXP)

argatroban pharmacodynamics pathway (EXP)

bivalirudin pharmacodynamics pathway (EXP)

coagulation cascade pathway (IEA,TAS)

complement system pathway (IEA)

dicoumarol pharmacodynamics pathway (EXP)

enoxaparin pharmacodynamics pathway (EXP)

ephrin - ephrin receptor bidirectional signaling axis (EXP)

fibrinolysis pathway (TAS)

fondaparinux pharmacodynamics pathway (EXP)

heparin pharmacodynamics pathway (EXP)

phenindione pharmacodynamics pathway (EXP)

reteplase pharmacodynamics pathway (EXP)

tranexamic acid pharmacodynamics pathway (EXP)

warfarin pharmacodynamics pathway (EXP)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Abnormal bleeding (IAGP)

Afibrinogenemia (IAGP)

Autosomal dominant inheritance (IAGP)

Autosomal recessive inheritance (IAGP)

Cerebral hemorrhage (IAGP)

Cholestasis (IAGP)

Deep venous thrombosis (IAGP)

Dysfibrinogenemia (IAGP)

Edema (IAGP)

Epistaxis (IAGP)

Gastrointestinal hemorrhage (IAGP)

Generalized amyloid deposition (IAGP)

Gingival bleeding (IAGP)

Hematuria (IAGP)

Hepatomegaly (IAGP)

Hypertension (IAGP)

Hypofibrinogenemia (IAGP)

Joint swelling (IAGP)

Menometrorrhagia (IAGP)

Miscarriage (IAGP)

Nephropathy (IAGP)

Nephrotic syndrome (IAGP)

Prolonged partial thromboplastin time (IAGP)

Proteinuria (IAGP)

Skin rash (IAGP)

Splenic rupture (IAGP)

Splenomegaly (IAGP)

Thrombocytopenia (IAGP)

Venous thrombosis (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Therapy with interleukin-22 alleviates hepatic injury and hemostasis dysregulation in rat model of acute liver failure.	Ashour TH Adv Hematol. 2014;2014:705290. doi: 10.1155/2014/705290. Epub 2014 Apr 1.
2.	Serum peptidome based biomarkers searching for monitoring minimal residual disease in adult acute lymphocytic leukemia.	Bai J, etal., Proteome Sci. 2014 Sep 16;12(1):49. doi: 10.1186/s12953-014-0049-y. eCollection 2014.
3.	Preliminary identification of differentially expressed tear proteins in keratoconus.	Balasubramanian SA, etal., Mol Vis. 2013 Oct 30;19:2124-34. eCollection 2013.
4.	The effects of melatonin on burn-induced inflammatory responses and coagulation disorders in rats.	Bekyarova G, etal., Methods Find Exp Clin Pharmacol. 2010 Jun;32(5):299-303.
5.	Hereditary renal amyloidosis associated with a mutant fibrinogen alpha-chain.	Benson MD, etal., Nat Genet. 1993 Mar;3(3):252-5.
6.	alpha-fibrinogen Thr312Ala polymorphism and venous thromboembolism.	Carter AM, etal., Blood. 2000 Aug 1;96(3):1177-9.
7.	Quantitative organellar proteomics analysis of rough endoplasmic reticulum from normal and acute pancreatitis rat pancreas.	Chen X, etal., J Proteome Res. 2010 Feb 5;9(2):885-96.
8.	Hypoglycemic dipeptide cyclo (His-Pro) significantly altered plasma proteome in streptozocin-induced diabetic rats and genetically-diabetic (ob/ob) mice.	Choi SA, etal., Mol Biol Rep. 2013 Feb;40(2):1753-65. doi: 10.1007/s11033-012-2229-0. Epub 2012 Oct 20.
9.	Puerarin attenuates ovalbumin-induced lung inflammation and hemostatic unbalance in rat asthma model.	Dong F, etal., Evid Based Complement Alternat Med. 2014;2014:726740. doi: 10.1155/2014/726740. Epub 2014 Jan 2.
10.	The effects of sleep hypoxia on coagulant factors and hepatic inflammation in emphysematous rats.	Feng J, etal., PLoS One. 2010 Oct 6;5(10):e13201. doi: 10.1371/journal.pone.0013201.
11.	Enoxaparin attenuates endothelial damage with less bleeding compared with unfractionated heparin in endotoxemic rats.	Iba T and Takayama T, Shock. 2009 Nov;32(5):530-4. doi: 10.1097/SHK.0b013e3181a2e279.
12.	[Protective effects and anticoagulation effect of polysaccharides from the sea cucumber on acute incomplete cerebral ischemia in rats].	Jiang X, etal., Zhongguo Ying Yong Sheng Li Xue Za Zhi. 2012 Mar;28(2):170-2.
13.	Identification of potential biomarkers by serum proteomics analysis in rats with sepsis.	Jiao J, etal., Shock. 2014 Jul;42(1):75-81. doi: 10.1097/SHK.0000000000000173.
14.	Down-regulated expression of AQP5 on lung in rat DIC model induced by LPS and its effect on the development of pulmonary edema.	Jin Y, etal., Pulm Pharmacol Ther. 2013 Dec;26(6):661-5. doi: 10.1016/j.pupt.2013.03.013. Epub 2013 Mar 26.
15.	Haemostatic abnormalities persist despite glycaemic improvement by insulin therapy in lean type 2 diabetic patients.	Knobl P, etal., Thromb Haemost. 1994 Jun;71(6):692-7.
16.	Fibrinogen beta-derived Bbeta(15-42) peptide protects against kidney ischemia/reperfusion injury.	Krishnamoorthy A, etal., Blood. 2011 Aug 18;118(7):1934-42. Epub 2011 Jun 17.
17.	The fibrin-derived peptide bbeta15-42 attenuates liver damage in a rat model of liver ischemia/reperfusion injury.	Liu A, etal., Shock. 2013 Apr;39(4):397-403. doi: 10.1097/SHK.0b013e31828c2b75.
18.	[Experimental anticoagulant therapy of acute lung injury induced by paraquat].	Liu F, etal., Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2012 Mar;30(3):190-3.
19.	Basic mechanisms and regulation of fibrinolysis.	Longstaff C and Kolev K, J Thromb Haemost. 2015 Jun;13 Suppl 1:S98-105. doi: 10.1111/jth.12935.
20.	Identification of genetic risk variants for deep vein thrombosis by multiplexed next-generation sequencing of 186 hemostatic/pro-inflammatory genes.	Lotta LA, etal., BMC Med Genomics. 2012 Feb 21;5(1):7.
21.	Fibrinogen and fibrin structure and functions.	Mosesson MW J Thromb Haemost. 2005 Aug;3(8):1894-904.
22.	A label-free nano-liquid chromatography-mass spectrometry approach for quantitative serum peptidomics in Crohn's disease patients.	Nanni P, etal., J Chromatogr B Analyt Technol Biomed Life Sci. 2009 Oct 1;877(27):3127-36. Epub 2009 Aug 7.
23.	The 11 kb FGA deletion responsible for congenital afibrinogenaemia is mediated by a short direct repeat in the fibrinogen gene cluster.	Neerman-Arbez M, etal., Eur J Hum Genet. 1999 Dec;7(8):897-902.
24.	Antiplatelet and antithrombotic effects of platelet glycoprotein IIb/IIIa (GPIIb/IIIa) inhibition by arginine-glycine-aspartic acid-serine (RGDS) and arginine-glycine-aspartic acid (RGD) (O-me)Y (SC-46749).	Nicholson NS, etal., J Pharmacol Exp Ther. 1991 Mar;256(3):876-82.
25.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
26.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
27.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
28.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
29.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
30.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
32.	RGD HPO Phenotype Annotation Pipeline	RGD automated import pipeline for human HPO-to-gene-to-disease annotations
33.	Prediction of nephrotoxicant action and identification of candidate toxicity-related biomarkers.	Thukral SK, etal., Toxicol Pathol. 2005;33(3):343-55.
34.	Haplotypes of the fibrinogen gene and cerebral small vessel disease: the Rotterdam scan study.	van Oijen M, etal., J Neurol Neurosurg Psychiatry. 2008 Jul;79(7):799-803. Epub 2007 Oct 19.
35.	Congenital afibrinogenaemia in a newborn infant due to a novel mutation in the fibrinogen aalpha gene.	Vlietman JJ, etal., Br J Haematol. 2002 Oct;119(1):282-3.
36.	Pre-treatment with bone marrow-derived mesenchymal stem cells inhibits systemic intravascular coagulation and attenuates organ dysfunction in lipopolysaccharide-induced disseminated intravascular coagulation rat model.	Wang B, etal., Chin Med J (Engl). 2012 May;125(10):1753-9.
37.	Intravenous release of NO from lipidic microbubbles accelerates deep vein thrombosis resolution in a rat model.	Wang C, etal., Thromb Res. 2013 Jan;131(1):e31-8. doi: 10.1016/j.thromres.2012.11.002. Epub 2012 Nov 28.
38.	Identification of novel biomarkers in seasonal allergic rhinitis by combining proteomic, multivariate and pathway analysis.	Wang H, etal., PLoS One. 2011;6(8):e23563. Epub 2011 Aug 24.
39.	Proteomics of microparticles after experimental pulmonary embolism.	Watts JA, etal., Thromb Res. 2011 Oct 17.
40.	A novel nonsense mutation in the FGA gene in a Chinese family with congenital afibrinogenaemia.	Wu S, etal., Blood Coagul Fibrinolysis. 2005 Apr;16(3):221-6.

Additional References at PubMed

PMID:518845	PMID:518846	PMID:632262	PMID:936108	PMID:1391954	PMID:1457396	PMID:1560020	PMID:1587268	PMID:1634621	PMID:1675636	PMID:1680863	PMID:1912564
PMID:2070049	PMID:2102623	PMID:2133223	PMID:2133234	PMID:2367530	PMID:2738154	PMID:2742826	PMID:2877981	PMID:3088041	PMID:3345340	PMID:3590111	PMID:3618591
PMID:4052020	PMID:4084461	PMID:4250289	PMID:5084810	PMID:5645286	PMID:6165239	PMID:6266066	PMID:6281794	PMID:6318767	PMID:6383194	PMID:6500566	PMID:6575389
PMID:6575700	PMID:6688355	PMID:6689067	PMID:6719396	PMID:6777381	PMID:7298640	PMID:7356959	PMID:8100742	PMID:8140431	PMID:8384496	PMID:8400261	PMID:8461606
PMID:8473507	PMID:8589203	PMID:8636415	PMID:8639778	PMID:8675656	PMID:8910396	PMID:8939956	PMID:8944230	PMID:9058485	PMID:9182580	PMID:9276466	PMID:9333233
PMID:9389696	PMID:9485375	PMID:9628725	PMID:9689040	PMID:9867861	PMID:10074346	PMID:10391209	PMID:10467729	PMID:10605720	PMID:10891444	PMID:10903502	PMID:10913112
PMID:10954706	PMID:10956659	PMID:10963790	PMID:11054085	PMID:11159525	PMID:11170397	PMID:11435303	PMID:11460491	PMID:11460506	PMID:11529842	PMID:11546832	PMID:11562340
PMID:11583334	PMID:11739173	PMID:11776317	PMID:11833854	PMID:11858505	PMID:11900554	PMID:11914657	PMID:12009908	PMID:12050338	PMID:12117709	PMID:12119191	PMID:12193970
PMID:12356313	PMID:12406899	PMID:12430881	PMID:12477932	PMID:12617173	PMID:12665801	PMID:12706644	PMID:12707238	PMID:12729597	PMID:12871600	PMID:12878203	PMID:14615374
PMID:14667819	PMID:14718574	PMID:14746139	PMID:14751930	PMID:15146197	PMID:15166913	PMID:15174051	PMID:15203218	PMID:15217804	PMID:15311936	PMID:15346842	PMID:15637140
PMID:15735812	PMID:15739255	PMID:15795540	PMID:15795809	PMID:15831156	PMID:15865460	PMID:15968394	PMID:16005629	PMID:16086292	PMID:16144795	PMID:16210568	PMID:16263253
PMID:16324093	PMID:16335952	PMID:16362348	PMID:16466010	PMID:16468976	PMID:16525568	PMID:16581250	PMID:16614319	PMID:16698114	PMID:16706972	PMID:16712791	PMID:16807684
PMID:16846481	PMID:16881935	PMID:16894470	PMID:16928957	PMID:16939214	PMID:16940416	PMID:17241179	PMID:17263791	PMID:17264959	PMID:17275949	PMID:17295221	PMID:17303222
PMID:17408411	PMID:17408725	PMID:17414213	PMID:17433418	PMID:17565234	PMID:17568659	PMID:17591786	PMID:17596138	PMID:17630702	PMID:17643375	PMID:17650077	PMID:17688324
PMID:17701467	PMID:17849064	PMID:17849175	PMID:17982313	PMID:17994314	PMID:18057060	PMID:18202324	PMID:18208536	PMID:18227259	PMID:18278190	PMID:18294856	PMID:18331453
PMID:18500534	PMID:18676163	PMID:18690352	PMID:18772067	PMID:18842294	PMID:18848323	PMID:18974842	PMID:19056867	PMID:19136375	PMID:19143925	PMID:19190816	PMID:19193866
PMID:19350124	PMID:19412134	PMID:19420105	PMID:19429776	PMID:19468208	PMID:19507189	PMID:19515723	PMID:19572064	PMID:19631771	PMID:19696023	PMID:19698251	PMID:19718467
PMID:19729601	PMID:19750100	PMID:19899640	PMID:19913121	PMID:19923982	PMID:19928926	PMID:19948975	PMID:19967163	PMID:20019599	PMID:20031577	PMID:20051841	PMID:20059469
PMID:20128871	PMID:20167083	PMID:20217997	PMID:20218626	PMID:20237496	PMID:20360068	PMID:20416077	PMID:20533267	PMID:20628086	PMID:20677013	PMID:20709368	PMID:20806111
PMID:20829681	PMID:21063468	PMID:21190511	PMID:21190668	PMID:21192254	PMID:21224475	PMID:21245743	PMID:21248064	PMID:21258858	PMID:21420681	PMID:21459789	PMID:21464904
PMID:21502573	PMID:21694469	PMID:21757653	PMID:21800001	PMID:21806028	PMID:21873635	PMID:21891970	PMID:21932842	PMID:21980494	PMID:22342352	PMID:22397628	PMID:22407772
PMID:22489912	PMID:22516433	PMID:22552295	PMID:22582013	PMID:22639050	PMID:22642105	PMID:22705885	PMID:22713578	PMID:22795623	PMID:22819533	PMID:22836683	PMID:23020230
PMID:23056168	PMID:23061815	PMID:23224113	PMID:23238100	PMID:23303819	PMID:23314748	PMID:23376485	PMID:23382103	PMID:23533145	PMID:23551149	PMID:23612884	PMID:23639427
PMID:23725126	PMID:23750785	PMID:23852822	PMID:23877568	PMID:23894515	PMID:23958299	PMID:23969696	PMID:24040290	PMID:24041635	PMID:24048413	PMID:24122271	PMID:24192574
PMID:24337577	PMID:24367264	PMID:24627488	PMID:24769233	PMID:24803720	PMID:24821635	PMID:24981860	PMID:25037231	PMID:25163824	PMID:25182841	PMID:25241761	PMID:25275549
PMID:25280629	PMID:25347092	PMID:25393591	PMID:25555432	PMID:25569856	PMID:25896761	PMID:25914268	PMID:25923092	PMID:25981141	PMID:26083984	PMID:26091039	PMID:26139837
PMID:26186194	PMID:26228839	PMID:26256740	PMID:26354767	PMID:26496610	PMID:26540126	PMID:26581183	PMID:26871637	PMID:26951791	PMID:27044366	PMID:27099386	PMID:27105953
PMID:27164460	PMID:27221710	PMID:27231021	PMID:27266621	PMID:27519977	PMID:27555433	PMID:27738342	PMID:27760719	PMID:28119309	PMID:28192448	PMID:28203040	PMID:28219450
PMID:28269756	PMID:28344315	PMID:28350862	PMID:28359658	PMID:28425010	PMID:28514442	PMID:28675934	PMID:28750085	PMID:28816342	PMID:28851981	PMID:29016666	PMID:29021578
PMID:29089309	PMID:29240685	PMID:29509190	PMID:29540212	PMID:29662311	PMID:29748775	PMID:29791485	PMID:29874984	PMID:29932420	PMID:30039577	PMID:30106150	PMID:30838756
PMID:31041195	PMID:31180492	PMID:31253657	PMID:31260799	PMID:31273033	PMID:31295712	PMID:31343282	PMID:31443619	PMID:31511434	PMID:31515786	PMID:31625351	PMID:31713292
PMID:31725541	PMID:31740226	PMID:31845492	PMID:31992359	PMID:32126779	PMID:32205365	PMID:32286477	PMID:32296183	PMID:32497950	PMID:32638959	PMID:32877691	PMID:32877852
PMID:32967043	PMID:33317138	PMID:33374030	PMID:33472402	PMID:33845483	PMID:33901106	PMID:33961781	PMID:34061326	PMID:34255402	PMID:34711951	PMID:34732716	PMID:34830348
PMID:34830419	PMID:35271311	PMID:35391932	PMID:35498401

Genomics

Comparative Map Data

FGA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	154,583,126 - 154,590,742 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	154,583,128 - 154,590,745 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	155,504,278 - 155,511,894 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	155,723,730 - 155,731,347 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	4	155,864,033 - 155,869,470	NCBI
Celera	4	152,835,246 - 152,842,862 (-)	NCBI
Cytogenetic Map	4	q31.3	NCBI
HuRef	4	151,244,861 - 151,252,473 (-)	NCBI		HuRef
CHM1_1	4	155,482,201 - 155,489,817 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	157,914,895 - 157,922,551 (-)	NCBI

Fga
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	82,933,460 - 82,940,934 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	3	82,933,383 - 82,940,934 (+)	Ensembl
GRCm38	3	83,026,153 - 83,033,627 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	83,026,076 - 83,033,627 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	82,830,075 - 82,837,549 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	3	83,112,081 - 83,118,197 (+)	NCBI			mm8
Celera	3	83,030,275 - 83,037,743 (+)	NCBI		Celera
Cytogenetic Map	3	E3	NCBI
cM Map	3	36.96	NCBI

Fga
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	168,365,364 - 168,381,533 (+)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	2	168,374,120 - 168,381,528 (+)	Ensembl
Rnor_6.0	2	181,997,562 - 182,013,726 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	182,006,242 - 182,013,763 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	201,412,182 - 201,428,346 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	174,737,640 - 174,753,598 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	2	174,694,725 - 174,703,904 (+)	NCBI
Celera	2	162,392,064 - 162,408,023 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

Fga
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955471	8,806,650 - 8,816,791 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955471	8,806,964 - 8,814,671 (+)	NCBI	ChiLan1.0	ChiLan1.0

FGA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	4	158,767,782 - 158,775,414 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	4	146,949,680 - 146,957,291 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

FGA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	52,238,305 - 52,247,017 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	52,236,198 - 52,246,975 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	52,584,628 - 52,591,483 (-)	NCBI
ROS_Cfam_1.0	15	52,924,743 - 52,933,990 (-)	NCBI
UMICH_Zoey_3.1	15	52,179,682 - 52,188,900 (-)	NCBI
UNSW_CanFamBas_1.0	15	52,283,995 - 52,293,478 (-)	NCBI
UU_Cfam_GSD_1.0	15	52,601,176 - 52,608,068 (-)	NCBI

Fga
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	38,217,093 - 38,224,715 (+)	NCBI
SpeTri2.0	NW_004936576	1,322,406 - 1,329,743 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FGA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	74,574,882 - 74,584,202 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	74,574,870 - 74,584,202 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	78,935,842 - 78,938,718 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FGA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	101,127,554 - 101,134,881 (-)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	7	101,125,791 - 101,134,405 (-)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666037	80,782,883 - 80,789,839 (-)	NCBI	Vero_WHO_p1.0

Fga
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624858	5,848,817 - 5,856,448 (+)	NCBI	HetGla_female_1.0		hetGla2

Position Markers

D4S3286

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,504,351 - 155,504,480	UniSTS	GRCh37
Build 36	4	155,723,801 - 155,723,930	RGD	NCBI36
Celera	4	152,835,317 - 152,835,446	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,244,932 - 151,245,061	UniSTS
TNG Radiation Hybrid Map	4	93091.0	UniSTS
GeneMap99-G3 RH Map	4	8495.0	UniSTS

STS-H58121

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,092 - 155,507,239	UniSTS	GRCh37
Build 36	4	155,726,542 - 155,726,689	RGD	NCBI36
Celera	4	152,838,058 - 152,838,205	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,673 - 151,247,820	UniSTS
TNG Radiation Hybrid Map	4	93091.0	UniSTS
GeneMap99-GB4 RH Map	4	636.0	UniSTS
NCBI RH Map	4	1584.6	UniSTS

SHGC-59324

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,212 - 155,507,339	UniSTS	GRCh37
Build 36	4	155,726,662 - 155,726,789	RGD	NCBI36
Celera	4	152,838,178 - 152,838,305	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,793 - 151,247,920	UniSTS
GeneMap99-GB4 RH Map	4	635.41	UniSTS
Whitehead-RH Map	4	685.9	UniSTS
NCBI RH Map	4	1584.6	UniSTS

SHGC-34795

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,150 - 155,507,276	UniSTS	GRCh37
Build 36	4	155,726,600 - 155,726,726	RGD	NCBI36
Celera	4	152,838,116 - 152,838,242	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,731 - 151,247,857	UniSTS
Stanford-G3 RH Map	4	8523.0	UniSTS
GeneMap99-GB4 RH Map	4	632.82	UniSTS
Whitehead-RH Map	4	689.7	UniSTS
NCBI RH Map	4	1584.4	UniSTS
GeneMap99-G3 RH Map	4	8448.0	UniSTS

GDB:187393

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,786 - 155,507,984	UniSTS	GRCh37
Build 36	4	155,727,236 - 155,727,434	RGD	NCBI36
Celera	4	152,838,752 - 152,838,950	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,248,367 - 151,248,565	UniSTS

GDB:215015

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,508,767 - 155,509,040	UniSTS	GRCh37
Build 36	4	155,728,217 - 155,728,490	RGD	NCBI36
Celera	4	152,839,733 - 152,840,005	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,249,348 - 151,249,617	UniSTS

GDB:374018

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,505,122 - 155,506,052	UniSTS	GRCh37
Build 36	4	155,724,572 - 155,725,502	RGD	NCBI36
Celera	4	152,836,088 - 152,837,018	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,245,703 - 151,246,633	UniSTS

D4S2882

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,504,531 - 155,504,690	UniSTS	GRCh37
Build 36	4	155,723,981 - 155,724,140	RGD	NCBI36
Celera	4	152,835,497 - 152,835,656	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,245,112 - 151,245,271	UniSTS
Whitehead-YAC Contig Map	4		UniSTS

SHGC-59770

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,506,493 - 155,506,676	UniSTS	GRCh37
Build 36	4	155,725,943 - 155,726,126	RGD	NCBI36
Celera	4	152,837,459 - 152,837,642	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,074 - 151,247,257	UniSTS
GeneMap99-GB4 RH Map	4	634.17	UniSTS
NCBI RH Map	4	1613.3	UniSTS

RH18276

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,258 - 155,507,454	UniSTS	GRCh37
Build 36	4	155,726,708 - 155,726,904	RGD	NCBI36
Celera	4	152,838,224 - 152,838,420	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,839 - 151,248,035	UniSTS
GeneMap99-GB4 RH Map	4	635.9	UniSTS
NCBI RH Map	4	1584.6	UniSTS

STS-H72060

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,505,242 - 155,505,383	UniSTS	GRCh37
Build 36	4	155,724,692 - 155,724,833	RGD	NCBI36
Celera	4	152,836,208 - 152,836,349	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,245,823 - 151,245,964	UniSTS
TNG Radiation Hybrid Map	4	93091.0	UniSTS
GeneMap99-GB4 RH Map	4	636.0	UniSTS
NCBI RH Map	4	1584.6	UniSTS

SHGC-32984

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,815 - 155,507,940	UniSTS	GRCh37
Build 36	4	155,727,265 - 155,727,390	RGD	NCBI36
Celera	4	152,838,781 - 152,838,906	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,248,396 - 151,248,521	UniSTS
TNG Radiation Hybrid Map	4	93091.0	UniSTS
GeneMap99-GB4 RH Map	4	636.0	UniSTS
Whitehead-RH Map	4	685.9	UniSTS
NCBI RH Map	4	1584.6	UniSTS
GeneMap99-G3 RH Map	4	8482.0	UniSTS

D4S3155

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,506,414 - 155,506,638	UniSTS	GRCh37
Build 36	4	155,725,864 - 155,726,088	RGD	NCBI36
Celera	4	152,837,380 - 152,837,604	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,246,995 - 151,247,219	UniSTS
TNG Radiation Hybrid Map	4	93091.0	UniSTS
Whitehead-YAC Contig Map	4		UniSTS
GeneMap99-G3 RH Map	4	8495.0	UniSTS

SHGC-50337

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,506,465 - 155,506,745	UniSTS	GRCh37
Build 36	4	155,725,915 - 155,726,195	RGD	NCBI36
Celera	4	152,837,431 - 152,837,711	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,046 - 151,247,326	UniSTS
TNG Radiation Hybrid Map	4	93131.0	UniSTS

FGA

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,508,848 - 155,509,043	UniSTS	GRCh37
Build 36	4	155,728,298 - 155,728,493	RGD	NCBI36
Celera	4	152,839,814 - 152,840,008	RGD
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,249,429 - 151,249,620	UniSTS

FGA_3978

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,504,251 - 155,505,172	UniSTS	GRCh37
Build 36	4	155,723,701 - 155,724,622	RGD	NCBI36
Celera	4	152,835,217 - 152,836,138	RGD

GDB:633003

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	155,507,255 - 155,507,838	UniSTS	GRCh37
Celera	4	152,838,221 - 152,838,804	UniSTS
Cytogenetic Map	4	q28	UniSTS
HuRef	4	151,247,836 - 151,248,419	UniSTS

G33492

Human Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	q28	UniSTS

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
MIR409	hsa-miR-409-3p	Mirtarbase	external_info	ELISA//Flow//Luciferase reporter assay	Non-Functional MTI	20570858
MIR29B1	hsa-miR-29b-3p	Mirtarbase	external_info	Luciferase reporter assay	Functional MTI	20570858
MIR29A	hsa-miR-29a-3p	Mirtarbase	external_info	Luciferase reporter assay	Functional MTI	20570858
MIR144	hsa-miR-144-3p	Mirtarbase	external_info	Luciferase reporter assay	Non-Functional MTI	20570858
MIR29B2	hsa-miR-29b-3p	Mirtarbase	external_info	Luciferase reporter assay	Functional MTI	20570858

Predicted Target Of

	Summary Value
Count of predictions:	558
Count of miRNA genes:	407
Interacting mature miRNAs:	434
Transcripts:	ENST00000302053, ENST00000403106
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

adipose tissue

appendage

entire extraembryonic component

High

407

Medium

214

131

Low

572

671

388

428

710

372

455

127

665

593

230

451

Below cutoff

973

1281

546

529

1610

935

1605

110

375

447

530

1043

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_008832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_000508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_021871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB087996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC107385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF090936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF229198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF361104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK290559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL531808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL579998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC020764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG565064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ064506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX494953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB122305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CD608675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CN393696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JB978078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	K02272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU178062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU178063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU178064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU178065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M26878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M58569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M64982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S82092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENST00000403106 ⟹ ENSP00000385981

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	4	154,585,275 - 154,590,742 (-)	Ensembl

RefSeq Acc Id:

ENST00000622532 ⟹ ENSP00000478487

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	4	154,585,281 - 154,590,744 (-)	Ensembl

RefSeq Acc Id:

ENST00000651975 ⟹ ENSP00000498441

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	4	154,583,128 - 154,590,745 (-)	Ensembl

RefSeq Acc Id:

NM_000508 ⟹ NP_000499

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	154,583,126 - 154,590,742 (-)	NCBI
GRCh37	4	155,504,280 - 155,511,897 (-)	ENTREZGENE
Build 36	4	155,723,730 - 155,731,347 (-)	NCBI Archive
HuRef	4	151,244,861 - 151,252,473 (-)	ENTREZGENE
CHM1_1	4	155,482,199 - 155,489,839 (-)	NCBI
T2T-CHM13v2.0	4	157,914,895 - 157,922,551 (-)	NCBI

Sequence:

show sequence

AATCCTTTCTTTCAGCTGGAGTGCTCCTCAGGAGCCAGCCCCACCCTTAGAAAAGATGTTTTCC
ATGAGGATCGTCTGCCTGGTCCTAAGTGTGGTGGGCACAGCATGGACTGCAGATAGTGGTGAAG
GTGACTTTCTAGCTGAAGGAGGAGGCGTGCGTGGCCCAAGGGTTGTGGAAAGACATCAATCTGC
CTGCAAAGATTCAGACTGGCCCTTCTGCTCTGATGAAGACTGGAACTACAAATGCCCTTCTGGC
TGCAGGATGAAAGGGTTGATTGATGAAGTCAATCAAGATTTTACAAACAGAATAAATAAGCTCA
AAAATTCACTATTTGAATATCAGAAGAACAATAAGGATTCTCATTCGTTGACCACTAATATAAT
GGAAATTTTGAGAGGCGATTTTTCCTCAGCCAATAACCGTGATAATACCTACAACCGAGTGTCA
GAGGATCTGAGAAGCAGAATTGAAGTCCTGAAGCGCAAAGTCATAGAAAAAGTACAGCATATCC
AGCTTCTGCAGAAAAATGTTAGAGCTCAGTTGGTTGATATGAAACGACTGGAGGTGGACATTGA
TATTAAGATCCGATCTTGTCGAGGGTCATGCAGTAGGGCTTTAGCTCGTGAAGTAGATCTGAAG
GACTATGAAGATCAGCAGAAGCAACTTGAACAGGTCATTGCCAAAGACTTACTTCCCTCTAGAG
ATAGGCAACACTTACCACTGATAAAAATGAAACCAGTTCCAGACTTGGTTCCCGGAAATTTTAA
GAGCCAGCTTCAGAAGGTACCCCCAGAGTGGAAGGCATTAACAGACATGCCGCAGATGAGAATG
GAGTTAGAGAGACCTGGTGGAAATGAGATTACTCGAGGAGGCTCCACCTCTTATGGAACCGGAT
CAGAGACGGAAAGCCCCAGGAACCCTAGCAGTGCTGGAAGCTGGAACTCTGGGAGCTCTGGACC
TGGAAGTACTGGAAACCGAAACCCTGGGAGCTCTGGGACTGGAGGGACTGCAACCTGGAAACCT
GGGAGCTCTGGACCTGGAAGTACTGGAAGCTGGAACTCTGGGAGCTCTGGAACTGGAAGTACTG
GAAACCAAAACCCTGGGAGCCCTAGACCTGGTAGTACCGGAACCTGGAATCCTGGCAGCTCTGA
ACGCGGAAGTGCTGGGCACTGGACCTCTGAGAGCTCTGTATCTGGTAGTACTGGACAATGGCAC
TCTGAATCTGGAAGTTTTAGGCCAGATAGCCCAGGCTCTGGGAACGCGAGGCCTAACAACCCAG
ACTGGGGCACATTTGAAGAGGTGTCAGGAAATGTAAGTCCAGGGACAAGGAGAGAGTACCACAC
AGAAAAACTGGTCACTTCTAAAGGAGATAAAGAGCTCAGGACTGGTAAAGAGAAGGTCACCTCT
GGTAGCACAACCACCACGCGTCGTTCATGCTCTAAAACCGTTACTAAGACTGTTATTGGTCCTG
ATGGTCACAAAGAAGTTACCAAAGAAGTGGTGACCTCCGAAGATGGTTCTGACTGTCCCGAGGC
AATGGATTTAGGCACATTGTCTGGCATAGGTACTCTGGATGGGTTCCGCCATAGGCACCCTGAT
GAAGCTGCCTTCTTCGACACTGCCTCAACTGGAAAAACATTCCCAGGTTTCTTCTCACCTATGT
TAGGAGAGTTTGTCAGTGAGACTGAGTCTAGGGGCTCAGAATCTGGCATCTTCACAAATACAAA
GGAATCCAGTTCTCATCACCCTGGGATAGCTGAATTCCCTTCCCGTGGTAAATCTTCAAGTTAC
AGCAAACAATTTACTAGTAGCACGAGTTACAACAGAGGAGACTCCACATTTGAAAGCAAGAGCT
ATAAAATGGCAGATGAGGCCGGAAGTGAAGCCGATCATGAAGGAACACATAGCACCAAGAGAGG
CCATGCTAAATCTCGCCCTGTCAGAGACTGTGATGATGTCCTCCAAACACATCCTTCAGGTACC
CAAAGTGGCATTTTCAATATCAAGCTACCGGGATCCAGTAAGATTTTTTCTGTTTATTGCGATC
AAGAGACCAGTTTGGGAGGATGGCTTTTGATCCAGCAAAGAATGGATGGATCACTGAATTTTAA
CCGGACCTGGCAAGACTACAAGAGAGGTTTCGGCAGCCTGAATGACGAGGGGGAAGGAGAATTC
TGGCTAGGCAATGACTACCTCCACTTACTAACCCAAAGGGGCTCTGTTCTTAGGGTTGAATTAG
AGGACTGGGCTGGGAATGAAGCTTATGCAGAATATCACTTCCGGGTAGGCTCTGAGGCTGAAGG
CTATGCCCTCCAAGTCTCCTCCTATGAAGGCACTGCGGGTGATGCTCTGATTGAGGGTTCCGTA
GAGGAAGGGGCAGAGTACACCTCTCACAACAACATGCAGTTCAGCACCTTTGACAGGGATGCAG
ACCAGTGGGAAGAGAACTGTGCAGAAGTCTATGGGGGAGGCTGGTGGTATAATAACTGCCAAGC
AGCCAATCTCAATGGAATCTACTACCCTGGGGGCTCCTATGACCCAAGGAATAACAGTCCTTAT
GAGATTGAGAATGGAGTGGTCTGGGTTTCCTTTAGAGGGGCAGATTATTCCCTCAGGGCTGTTC
GCATGAAAATTAGGCCCCTTGTGACCCAATAGGCTGAAGAAGTGGGAATGGGAGCACTCTGTCT
TCTTTGCTAGAGAAGTGGAGAGAAAATACAAAAGGTAAAGCAGTTGAGATTCTCTACAACCTAA
AAAATTCCTAGGTGCTATTTTCTTATCCTTTGTACTGTAGCTAAATGTACCTGAGACATATTAG
TCTTTGAAAAATAAAGTTATGTAAGGTTTTTTTTATCTTTAAATAGCTCTGTGGGTTTTAACAT
TTTTATAAAGATATACCAAGGGCCATTCAGTACATCAGGAAAGTGGCAGACAGAAGCTTCTCTC
TGCAACCTTGAAGACTATTGGTTTGAGAACTTCTCTTCCCATACCACCCAAAATCATAATGCCA
TTGGAAAGCAAAAAGTTGTTTTATCCATTTGATTTGAATTGTTTTAAGCCAATATTTTAAGGTA
AAACTCACTGAATCTAACCATAGCTGACCTTTGTAGTAGAATTTACAACTTATAATTACAATGC
ACAATTTATAATTACAATATGTATTTATGTCTTTTGCTATGGAGCAAATCCAGGAAGGCAAGAG
AAACATTCTTTCCTAAATATAAATGAAAATCTATCCTTTAAACTCTTCCACTAGACGTTGTAAT
GCACACTTATTTTTTTCCCAAGGAGTAACCAATTTCTTTCTAAAACACATTTAAAATTTTAAAA
CTATTTATGAATATTAAAAAAAGACATAATTCACACATTAATAAACAATCTCCCAAGTATTGAT
TTAACTTCATTTTTCTAATAATCATAAACTATATTCTGTGACATGCTAATTATTATTAAATGTA
AGTCGTTAGTTCGAAAGCCTCTCACTAAGTATGATCTATGCTATATTCAAAATTCAACCCATTT
ACTTTGGTCAATATTTGATCTAAGTTGCATCTTTAATCCTGGTGGTCTTGCCTTCTGATTTTTA
ATTTGTATCCTTTTCTATTAAGATATATTTGTCATTTTCTCTTGAATATGTATTAAAATATCCC
AAGCAA

hide sequence

RefSeq Acc Id:

NM_021871 ⟹ NP_068657

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	154,585,275 - 154,590,742 (-)	NCBI
GRCh37	4	155,504,280 - 155,511,897 (-)	ENTREZGENE
Build 36	4	155,725,879 - 155,731,347 (-)	NCBI Archive
HuRef	4	151,244,861 - 151,252,473 (-)	ENTREZGENE
CHM1_1	4	155,484,333 - 155,489,839 (-)	NCBI
T2T-CHM13v2.0	4	157,917,072 - 157,922,551 (-)	NCBI

Sequence:

show sequence

AATCCTTTCTTTCAGCTGGAGTGCTCCTCAGGAGCCAGCCCCACCCTTAGAAAAGATGTTTTCC
ATGAGGATCGTCTGCCTGGTCCTAAGTGTGGTGGGCACAGCATGGACTGCAGATAGTGGTGAAG
GTGACTTTCTAGCTGAAGGAGGAGGCGTGCGTGGCCCAAGGGTTGTGGAAAGACATCAATCTGC
CTGCAAAGATTCAGACTGGCCCTTCTGCTCTGATGAAGACTGGAACTACAAATGCCCTTCTGGC
TGCAGGATGAAAGGGTTGATTGATGAAGTCAATCAAGATTTTACAAACAGAATAAATAAGCTCA
AAAATTCACTATTTGAATATCAGAAGAACAATAAGGATTCTCATTCGTTGACCACTAATATAAT
GGAAATTTTGAGAGGCGATTTTTCCTCAGCCAATAACCGTGATAATACCTACAACCGAGTGTCA
GAGGATCTGAGAAGCAGAATTGAAGTCCTGAAGCGCAAAGTCATAGAAAAAGTACAGCATATCC
AGCTTCTGCAGAAAAATGTTAGAGCTCAGTTGGTTGATATGAAACGACTGGAGGTGGACATTGA
TATTAAGATCCGATCTTGTCGAGGGTCATGCAGTAGGGCTTTAGCTCGTGAAGTAGATCTGAAG
GACTATGAAGATCAGCAGAAGCAACTTGAACAGGTCATTGCCAAAGACTTACTTCCCTCTAGAG
ATAGGCAACACTTACCACTGATAAAAATGAAACCAGTTCCAGACTTGGTTCCCGGAAATTTTAA
GAGCCAGCTTCAGAAGGTACCCCCAGAGTGGAAGGCATTAACAGACATGCCGCAGATGAGAATG
GAGTTAGAGAGACCTGGTGGAAATGAGATTACTCGAGGAGGCTCCACCTCTTATGGAACCGGAT
CAGAGACGGAAAGCCCCAGGAACCCTAGCAGTGCTGGAAGCTGGAACTCTGGGAGCTCTGGACC
TGGAAGTACTGGAAACCGAAACCCTGGGAGCTCTGGGACTGGAGGGACTGCAACCTGGAAACCT
GGGAGCTCTGGACCTGGAAGTACTGGAAGCTGGAACTCTGGGAGCTCTGGAACTGGAAGTACTG
GAAACCAAAACCCTGGGAGCCCTAGACCTGGTAGTACCGGAACCTGGAATCCTGGCAGCTCTGA
ACGCGGAAGTGCTGGGCACTGGACCTCTGAGAGCTCTGTATCTGGTAGTACTGGACAATGGCAC
TCTGAATCTGGAAGTTTTAGGCCAGATAGCCCAGGCTCTGGGAACGCGAGGCCTAACAACCCAG
ACTGGGGCACATTTGAAGAGGTGTCAGGAAATGTAAGTCCAGGGACAAGGAGAGAGTACCACAC
AGAAAAACTGGTCACTTCTAAAGGAGATAAAGAGCTCAGGACTGGTAAAGAGAAGGTCACCTCT
GGTAGCACAACCACCACGCGTCGTTCATGCTCTAAAACCGTTACTAAGACTGTTATTGGTCCTG
ATGGTCACAAAGAAGTTACCAAAGAAGTGGTGACCTCCGAAGATGGTTCTGACTGTCCCGAGGC
AATGGATTTAGGCACATTGTCTGGCATAGGTACTCTGGATGGGTTCCGCCATAGGCACCCTGAT
GAAGCTGCCTTCTTCGACACTGCCTCAACTGGAAAAACATTCCCAGGTTTCTTCTCACCTATGT
TAGGAGAGTTTGTCAGTGAGACTGAGTCTAGGGGCTCAGAATCTGGCATCTTCACAAATACAAA
GGAATCCAGTTCTCATCACCCTGGGATAGCTGAATTCCCTTCCCGTGGTAAATCTTCAAGTTAC
AGCAAACAATTTACTAGTAGCACGAGTTACAACAGAGGAGACTCCACATTTGAAAGCAAGAGCT
ATAAAATGGCAGATGAGGCCGGAAGTGAAGCCGATCATGAAGGAACACATAGCACCAAGAGAGG
CCATGCTAAATCTCGCCCTGTCAGAGGTATCCACACTTCTCCTTTGGGGAAGCCTTCCCTGTCC
CCCTAGACTAAGTTAAATATTTCTGCACAGTGTTCCCATGGCCCCTTGCATTTCCTTCTTAACT
CTCTGTTACACGTCATTGAAACTACACTTTTTTGGTCTGTTTTTGTGCTAGACTGTAAGTTCCT
TGGGGGCAGGGCCTTTGTCTGTCTCATCTCTGTATTCCCAAATGCCTAACAGTACAGAGCCATG
ACTCAATAAATACATGTTAAATGGATGAATGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_000499	(Get FASTA)	NCBI Sequence Viewer
	NP_068657	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA17055	(Get FASTA)	NCBI Sequence Viewer
	AAA17056	(Get FASTA)	NCBI Sequence Viewer
	AAA52426	(Get FASTA)	NCBI Sequence Viewer
	AAA52427	(Get FASTA)	NCBI Sequence Viewer
	AAA52428	(Get FASTA)	NCBI Sequence Viewer
	AAA52444	(Get FASTA)	NCBI Sequence Viewer
	AAB47117	(Get FASTA)	NCBI Sequence Viewer
	AAC97142	(Get FASTA)	NCBI Sequence Viewer
	AAC97143	(Get FASTA)	NCBI Sequence Viewer
	AAH20764	(Get FASTA)	NCBI Sequence Viewer
	AAH70246	(Get FASTA)	NCBI Sequence Viewer
	AAH98280	(Get FASTA)	NCBI Sequence Viewer
	AAH99706	(Get FASTA)	NCBI Sequence Viewer
	AAH99720	(Get FASTA)	NCBI Sequence Viewer
	AAI01936	(Get FASTA)	NCBI Sequence Viewer
	AAI05804	(Get FASTA)	NCBI Sequence Viewer
	AAK31372	(Get FASTA)	NCBI Sequence Viewer
	AAK31373	(Get FASTA)	NCBI Sequence Viewer
	ALQ33520	(Get FASTA)	NCBI Sequence Viewer
	ALQ33521	(Get FASTA)	NCBI Sequence Viewer
	ALQ33522	(Get FASTA)	NCBI Sequence Viewer
	ALQ33523	(Get FASTA)	NCBI Sequence Viewer
	BAC55116	(Get FASTA)	NCBI Sequence Viewer
	BAF83248	(Get FASTA)	NCBI Sequence Viewer
	CDL78900	(Get FASTA)	NCBI Sequence Viewer
	EAX04924	(Get FASTA)	NCBI Sequence Viewer
	EAX04925	(Get FASTA)	NCBI Sequence Viewer
	EAX04926	(Get FASTA)	NCBI Sequence Viewer
	EAX04927	(Get FASTA)	NCBI Sequence Viewer
	EAX04928	(Get FASTA)	NCBI Sequence Viewer
	P02671	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_000499 ⟸ NM_000508
- Peptide Label:	isoform alpha-E preproprotein
- UniProtKB:	Q9UCH2 (UniProtKB/Swiss-Prot), P02671 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKC PSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYN RVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREV DLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQLQKVPPEWKALTDMPQ MRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTAT WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSAGHWTSESSVSGSTG QWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEK VTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHR HPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKS SSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHP SGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGE GEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIE GSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNN SPYEIENGVVWVSFRGADYSLRAVRMKIRPLVTQ hide sequence

RefSeq Acc Id:	NP_068657 ⟸ NM_021871
- Peptide Label:	isoform alpha precursor
- UniProtKB:	P02671 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKC PSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYN RVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREV DLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQLQKVPPEWKALTDMPQ MRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTAT WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSAGHWTSESSVSGSTG QWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEK VTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHR HPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKS SSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVRGIHTSPLGKP SLSP hide sequence

RefSeq Acc Id:

ENSP00000478487 ⟸ ENST00000622532

RefSeq Acc Id:

ENSP00000498441 ⟸ ENST00000651975

RefSeq Acc Id:

ENSP00000385981 ⟸ ENST00000403106

Protein Domains

Fib_alpha Fibrinogen C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02671-F1-model_v2	AlphaFold	P02671	1-866	view protein structure

Promoters

RGD ID:

6868708

Promoter ID:

EPDNEW_H7519

Type:

initiation region

Name:

FGA_1

Description:

fibrinogen alpha chain

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	154,590,742 - 154,590,802	EPDNEW

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_021871.4(FGA):c.104G>A (p.Arg35His)	single nucleotide variant	Abnormal bleeding [RCV000851971]\|Dysfibrinogenemia [RCV000030941]\|Familial dysfibrinogenemia [RCV002228034]\|Hypofibrinogenemia [RCV000851581]\|not provided [RCV001509236]	Chr4:154589513 [GRCh38] Chr4:155510665 [GRCh37] Chr4:4q31.3	pathogenic\|likely pathogenic\|other
NM_000508.3(FGA):c.76G>A (p.Asp26Asn)	single nucleotide variant	FIBRINOGEN LILLE 1 [RCV000017823]	Chr4:154589541 [GRCh38] Chr4:155510693 [GRCh37] Chr4:4q31.3	other
NM_000508.3(FGA):c.92G>T (p.Gly31Val)	single nucleotide variant	FIBRINOGEN ROUEN 1 [RCV000017824]	Chr4:154589525 [GRCh38] Chr4:155510677 [GRCh37] Chr4:4q31.3	other
NM_000508.3(FGA):c.103C>T (p.Arg35Cys)	single nucleotide variant	Dysfibrinogenemia [RCV000017825]	Chr4:154589514 [GRCh38] Chr4:155510666 [GRCh37] Chr4:4q31.3	pathogenic\|other
FIBRINOGEN MUNICH 1	variation	FIBRINOGEN MUNICH 1 [RCV000017841]	Chr4:4q28	other
FIBRINOGEN DETROIT 1	variation	FIBRINOGEN DETROIT 1 [RCV000017842]	Chr4:4q28	other
NM_000508.3(FGA):c.112A>G (p.Arg38Gly)	single nucleotide variant	FIBRINOGEN AARHUS 1 [RCV000017843]\|Hypofibrinogenemia [RCV000851993]	Chr4:154589505 [GRCh38] Chr4:155510657 [GRCh37] Chr4:4q31.3	likely pathogenic\|other
NM_000508.3(FGA):c.110C>T (p.Pro37Leu)	single nucleotide variant	FIBRINOGEN KYOTO 2 [RCV000017844]	Chr4:154589507 [GRCh38] Chr4:155510659 [GRCh37] Chr4:4q31.3	other
NM_000508.3(FGA):c.1358G>A (p.Ser453Asn)	single nucleotide variant	FIBRINOGEN CARACAS 2 [RCV000017865]\|not provided [RCV001508522]	Chr4:154586071 [GRCh38] Chr4:155507223 [GRCh37] Chr4:4q31.3	uncertain significance\|other
FIBRINOGEN LIMA	variation	FIBRINOGEN LIMA [RCV000017866]	Chr4:4q28	other
NM_000508.3(FGA):c.1438A>T (p.Lys480Ter)	single nucleotide variant	FIBRINOGEN MARBURG [RCV000017867]	Chr4:154585991 [GRCh38] Chr4:155507143 [GRCh37] Chr4:4q31.3	pathogenic\|other
NM_021871.4(FGA):c.1718G>T (p.Arg573Leu)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV000017869]\|not provided [RCV001753419]	Chr4:154585711 [GRCh38] Chr4:155506863 [GRCh37] Chr4:4q31.3	pathogenic\|uncertain significance
NM_021871.4(FGA):c.1622del (p.Val541fs)	deletion	Familial visceral amyloidosis, Ostertag type [RCV000017870]	Chr4:154585807 [GRCh38] Chr4:155506959 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.1634A>T (p.Glu545Val)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV000017871]	Chr4:154585795 [GRCh38] Chr4:155506947 [GRCh37] Chr4:4q31.3	pathogenic
NM_000508.3(FGA):c.1717C>T (p.Arg573Cys)	single nucleotide variant	Deep venous thrombosis [RCV002222001]\|FIBRINOGEN DUSART [RCV000017872]	Chr4:154585712 [GRCh38] Chr4:155506864 [GRCh37] Chr4:4q31.3	likely pathogenic\|other
NM_000508.3(FGA):c.116T>A (p.Val39Asp)	single nucleotide variant	FIBRINOGEN CANTERBURY [RCV000017874]	Chr4:154589501 [GRCh38] Chr4:155510653 [GRCh37] Chr4:4q31.3	other
NM_021871.4(FGA):c.1629del (p.Thr544fs)	deletion	Familial visceral amyloidosis, Ostertag type [RCV000017875]	Chr4:154585800 [GRCh38] Chr4:155506952 [GRCh37] Chr4:4q31.3	pathogenic
NC_000004.12:g.(154580323_154580329)_(154590210_154590216)del	deletion	Congenital afibrinogenemia [RCV000017876]	Chr4:154580329..154590210 [GRCh38] Chr4:4q28	pathogenic
NM_021871.4(FGA):c.510+1G>T	single nucleotide variant	Congenital afibrinogenemia [RCV000017877]\|Familial hypodysfibrinogenemia [RCV000030942]\|Hypofibrinogenemia [RCV000851811]	Chr4:154587511 [GRCh38] Chr4:155508663 [GRCh37] Chr4:4q31.3	pathogenic
FIBRINOGEN NIEUWEGEIN	insertion	FIBRINOGEN NIEUWEGEIN [RCV000017878]	Chr4:4q28	other
NM_021871.4(FGA):c.711dup (p.Lys238Ter)	duplication	Congenital afibrinogenemia [RCV000017879]	Chr4:154586717..154586718 [GRCh38] Chr4:155507869..155507870 [GRCh37] Chr4:4q31.3	pathogenic
NM_000508.3(FGA):c.1039C>T (p.Gln347Ter)	single nucleotide variant	FIBRINOGEN KEOKUK [RCV000017880]	Chr4:154586390 [GRCh38] Chr4:155507542 [GRCh37] Chr4:4q31.3	other
NM_021871.4(FGA):c.991A>G (p.Thr331Ala)	single nucleotide variant	Congenital afibrinogenemia [RCV000338448]\|Familial visceral amyloidosis, Ostertag type [RCV000405212]\|Venous thromboembolism, susceptibility to [RCV000017882]\|not provided [RCV001509235]\|not specified [RCV000246757]	Chr4:154586438 [GRCh38] Chr4:155507590 [GRCh37] Chr4:4q31.3	risk factor\|benign\|conflicting interpretations of pathogenicity\|uncertain significance
NM_000508.5(FGA):c.2153C>A (p.Thr718Asn)	single nucleotide variant	not provided [RCV000722728]	Chr4:154584572 [GRCh38] Chr4:155505724 [GRCh37] Chr4:4q31.3	uncertain significance
GRCh38/hg38 4q26-35.2(chr4:118065569-190042639)x3	copy number gain	See cases [RCV000051785]	Chr4:118065569..190042639 [GRCh38] Chr4:118986724..190828225 [GRCh37] Chr4:119206172..191200788 [NCBI36] Chr4:4q26-35.2	pathogenic
GRCh38/hg38 4q27-35.2(chr4:121518223-190062270)x3	copy number gain	See cases [RCV000051786]	Chr4:121518223..190062270 [GRCh38] Chr4:122439378..190828225 [GRCh37] Chr4:122658828..191220419 [NCBI36] Chr4:4q27-35.2	pathogenic
GRCh38/hg38 4q31.22-34.1(chr4:147317283-173675559)x3	copy number gain	See cases [RCV000051788]	Chr4:147317283..173675559 [GRCh38] Chr4:148238435..174596710 [GRCh37] Chr4:148457885..174833285 [NCBI36] Chr4:4q31.22-34.1	pathogenic
GRCh38/hg38 4q31.23-35.2(chr4:148356485-189548183)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051789]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051789]\|See cases [RCV000051789]	Chr4:148356485..189548183 [GRCh38] Chr4:149277637..190469337 [GRCh37] Chr4:149497087..190706331 [NCBI36] Chr4:4q31.23-35.2	pathogenic
GRCh38/hg38 4q22.2-32.3(chr4:92913386-165299707)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|See cases [RCV000051775]	Chr4:92913386..165299707 [GRCh38] Chr4:93834537..166220859 [GRCh37] Chr4:94053560..166440309 [NCBI36] Chr4:4q22.2-32.3	pathogenic
GRCh38/hg38 4q31.3-32.1(chr4:153656785-154928773)x1	copy number loss	See cases [RCV000053324]	Chr4:153656785..154928773 [GRCh38] Chr4:154577937..155849925 [GRCh37] Chr4:154797387..156069375 [NCBI36] Chr4:4q31.3-32.1	pathogenic
GRCh38/hg38 4q31.3-32.1(chr4:151299810-160314050)x1	copy number loss	See cases [RCV000135696]	Chr4:151299810..160314050 [GRCh38] Chr4:152220962..161235202 [GRCh37] Chr4:152440412..161454652 [NCBI36] Chr4:4q31.3-32.1	likely pathogenic
GRCh38/hg38 4q31.21-35.2(chr4:145042668-189975519)x3	copy number gain	See cases [RCV000135845]	Chr4:145042668..189975519 [GRCh38] Chr4:145963820..190828225 [GRCh37] Chr4:146183270..191133668 [NCBI36] Chr4:4q31.21-35.2	pathogenic
GRCh38/hg38 4q31.1-35.2(chr4:138510532-189963195)x3	copy number gain	See cases [RCV000136810]	Chr4:138510532..189963195 [GRCh38] Chr4:139431686..190828225 [GRCh37] Chr4:139651136..191121344 [NCBI36] Chr4:4q31.1-35.2	pathogenic
GRCh38/hg38 4q28.3-35.2(chr4:131985253-190095391)x3	copy number gain	See cases [RCV000137721]	Chr4:131985253..190095391 [GRCh38] Chr4:132906408..190828225 [GRCh37] Chr4:133125858..191250527 [NCBI36] Chr4:4q28.3-35.2	pathogenic\|likely benign
GRCh38/hg38 4q28.1-35.1(chr4:125432943-185761887)x3	copy number gain	See cases [RCV000138578]	Chr4:125432943..185761887 [GRCh38] Chr4:126354098..186683041 [GRCh37] Chr4:126573548..186920035 [NCBI36] Chr4:4q28.1-35.1	pathogenic\|likely benign
GRCh38/hg38 4q28.3-35.2(chr4:134935616-190036318)x3	copy number gain	See cases [RCV000143559]	Chr4:134935616..190036318 [GRCh38] Chr4:135856771..190957473 [GRCh37] Chr4:136076221..191194467 [NCBI36] Chr4:4q28.3-35.2	pathogenic
GRCh38/hg38 4q31.3-32.1(chr4:152500649-155788803)x3	copy number gain	See cases [RCV000143617]	Chr4:152500649..155788803 [GRCh38] Chr4:153421801..156709955 [GRCh37] Chr4:153641251..156929405 [NCBI36] Chr4:4q31.3-32.1	likely pathogenic
GRCh37/hg19 4q28.3-35.1(chr4:136912336-184253252)x3	copy number gain	See cases [RCV000240245]	Chr4:136912336..184253252 [GRCh37] Chr4:4q28.3-35.1	pathogenic
NM_021871.4(FGA):c.923G>A (p.Arg308Gln)	single nucleotide variant	Congenital afibrinogenemia [RCV001148495]\|Familial visceral amyloidosis, Ostertag type [RCV001148496]\|not provided [RCV000224629]\|not specified [RCV001818547]	Chr4:154586506 [GRCh38] Chr4:155507658 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.616C>G (p.Gln206Glu)	single nucleotide variant	Congenital afibrinogenemia [RCV000279650]\|Familial visceral amyloidosis, Ostertag type [RCV000371491]	Chr4:154586813 [GRCh38] Chr4:155507965 [GRCh37] Chr4:4q31.3	likely benign\|uncertain significance
NM_021871.4(FGA):c.450G>A (p.Gln150=)	single nucleotide variant	Congenital afibrinogenemia [RCV000340627]\|Familial visceral amyloidosis, Ostertag type [RCV000283016]	Chr4:154587572 [GRCh38] Chr4:155508724 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.904C>G (p.Pro302Ala)	single nucleotide variant	Congenital afibrinogenemia [RCV000307705]\|Familial visceral amyloidosis, Ostertag type [RCV000268329]\|not provided [RCV000973688]	Chr4:154586525 [GRCh38] Chr4:155507677 [GRCh37] Chr4:4q31.3	benign\|likely benign
NM_000508.5(FGA):c.2586C>T (p.Pro862_Leu863=)	single nucleotide variant	not provided [RCV000961585]\|not specified [RCV000241967]	Chr4:154584139 [GRCh38] Chr4:155505291 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.1823G>C (p.Gly608Ala)	single nucleotide variant	Congenital afibrinogenemia [RCV000328375]\|Familial visceral amyloidosis, Ostertag type [RCV000270905]	Chr4:154585606 [GRCh38] Chr4:155506758 [GRCh37] Chr4:4q31.3	likely benign\|uncertain significance
NM_000508.5(FGA):c.7_34dup	duplication	not provided [RCV001668437]\|not specified [RCV000247066]	Chr4:154584089..154584090 [GRCh38] Chr4:155505241..155505242 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.-14C>T	single nucleotide variant	not specified [RCV000250194]	Chr4:154590701 [GRCh38] Chr4:155511853 [GRCh37] Chr4:4q31.3	likely benign
NM_021871.4(FGA):c.*50T>G	single nucleotide variant	Congenital afibrinogenemia [RCV000266418]\|Familial visceral amyloidosis, Ostertag type [RCV000358780]	Chr4:154585444 [GRCh38] Chr4:155506596 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
GRCh37/hg19 4q26-35.2(chr4:119437495-190904301)x3	copy number gain	See cases [RCV000240392]	Chr4:119437495..190904301 [GRCh37] Chr4:4q26-35.2	pathogenic
NM_021871.4(FGA):c.1199C>T (p.Ser400Phe)	single nucleotide variant	Congenital afibrinogenemia [RCV000299895]\|Familial visceral amyloidosis, Ostertag type [RCV000404272]	Chr4:154586230 [GRCh38] Chr4:155507382 [GRCh37] Chr4:4q31.3	benign\|likely benign
NM_021871.4(FGA):c.919A>G (p.Asn307Asp)	single nucleotide variant	Congenital afibrinogenemia [RCV000360629]\|Familial visceral amyloidosis, Ostertag type [RCV000303506]	Chr4:154586510 [GRCh38] Chr4:155507662 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1542T>C (p.Pro514=)	single nucleotide variant	Congenital afibrinogenemia [RCV000385254]\|Familial visceral amyloidosis, Ostertag type [RCV000293267]\|not provided [RCV000946817]	Chr4:154585887 [GRCh38] Chr4:155507039 [GRCh37] Chr4:4q31.3	benign\|likely benign
NM_021871.4(FGA):c.1838A>G (p.His613Arg)	single nucleotide variant	Congenital afibrinogenemia [RCV000381748]\|Familial visceral amyloidosis, Ostertag type [RCV000323812]	Chr4:154585591 [GRCh38] Chr4:155506743 [GRCh37] Chr4:4q31.3	benign\|likely benign\|uncertain significance
NM_021871.4(FGA):c.244A>C (p.Thr82Pro)	single nucleotide variant	Congenital afibrinogenemia [RCV000344051]\|Familial visceral amyloidosis, Ostertag type [RCV000404726]	Chr4:154588913 [GRCh38] Chr4:155510065 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.16A>G (p.Ile6Val)	single nucleotide variant	Congenital afibrinogenemia [RCV000366318]\|Familial visceral amyloidosis, Ostertag type [RCV000309151]\|not provided [RCV000953503]	Chr4:154590672 [GRCh38] Chr4:155511824 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.1417G>A (p.Asp473Asn)	single nucleotide variant	Congenital afibrinogenemia [RCV000296696]\|Familial visceral amyloidosis, Ostertag type [RCV000334967]\|not provided [RCV001702008]	Chr4:154586012 [GRCh38] Chr4:155507164 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.765G>A (p.Pro255=)	single nucleotide variant	Congenital afibrinogenemia [RCV000386537]\|Familial visceral amyloidosis, Ostertag type [RCV000329775]	Chr4:154586664 [GRCh38] Chr4:155507816 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.3(FGA):c.-58A>G	single nucleotide variant	Congenital afibrinogenemia [RCV000396755]\|Familial visceral amyloidosis, Ostertag type [RCV000312840]\|not provided [RCV001723948]	Chr4:154590745 [GRCh38] Chr4:155511897 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.1444G>A (p.Val482Met)	single nucleotide variant	Congenital afibrinogenemia [RCV000388685]\|Familial visceral amyloidosis, Ostertag type [RCV000350523]	Chr4:154585985 [GRCh38] Chr4:155507137 [GRCh37] Chr4:4q31.3	likely benign
NM_021871.4(FGA):c.822C>T (p.Ser274=)	single nucleotide variant	Congenital afibrinogenemia [RCV000364658]\|Familial visceral amyloidosis, Ostertag type [RCV000272340]	Chr4:154586607 [GRCh38] Chr4:155507759 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.666A>T (p.Pro222=)	single nucleotide variant	Congenital afibrinogenemia [RCV000275684]\|Familial visceral amyloidosis, Ostertag type [RCV000333223]	Chr4:154586763 [GRCh38] Chr4:155507915 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.346G>A (p.Asp116Asn)	single nucleotide variant	Congenital afibrinogenemia [RCV000402806]\|Familial visceral amyloidosis, Ostertag type [RCV000305519]	Chr4:154588811 [GRCh38] Chr4:155509963 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.614A>G (p.Glu205Gly)	single nucleotide variant	Congenital afibrinogenemia [RCV000337081]\|Familial visceral amyloidosis, Ostertag type [RCV000375396]	Chr4:154586815 [GRCh38] Chr4:155507967 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.193C>A (p.Pro65Thr)	single nucleotide variant	not provided [RCV000722253]	Chr4:154588964 [GRCh38] Chr4:155510116 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2434T>C (p.Cys812Arg)	single nucleotide variant	not provided [RCV000722976]	Chr4:154584291 [GRCh38] Chr4:155505443 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.502C>T (p.Arg168Ter)	single nucleotide variant	Congenital afibrinogenemia [RCV000454272]\|not provided [RCV001380954]	Chr4:154587520 [GRCh38] Chr4:155508672 [GRCh37] Chr4:4q31.3	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:12440-190904441)x3	copy number gain	See cases [RCV000446653]	Chr4:12440..190904441 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)	copy number gain	See cases [RCV000510453]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q31.3-35.2(chr4:153890440-190957473)x3	copy number gain	See cases [RCV000510713]	Chr4:153890440..190957473 [GRCh37] Chr4:4q31.3-35.2	pathogenic
GRCh37/hg19 4q31.3-32.2(chr4:153203431-162912359)x1	copy number loss	See cases [RCV000511404]	Chr4:153203431..162912359 [GRCh37] Chr4:4q31.3-32.2	pathogenic
GRCh37/hg19 4q25-35.2(chr4:109199664-189752726)x3	copy number gain	See cases [RCV000511945]	Chr4:109199664..189752726 [GRCh37] Chr4:4q25-35.2	pathogenic
GRCh37/hg19 4q22.1-35.2(chr4:93071152-190957473)x3	copy number gain	See cases [RCV000510970]	Chr4:93071152..190957473 [GRCh37] Chr4:4q22.1-35.2	pathogenic
NM_000508.5(FGA):c.2089G>A (p.Gly697Ser)	single nucleotide variant	AFib amyloidosis [RCV000627058]	Chr4:154584636 [GRCh38] Chr4:155505788 [GRCh37] Chr4:4q31.3	uncertain significance
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)x3	copy number gain	See cases [RCV000512241]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q31.3-32.1(chr4:154763131-158404825)x1	copy number loss	not provided [RCV000682474]	Chr4:154763131..158404825 [GRCh37] Chr4:4q31.3-32.1	likely pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190915650)x3	copy number gain	not provided [RCV000743155]	Chr4:49450..190915650 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190963766)x3	copy number gain	not provided [RCV000743156]	Chr4:49450..190963766 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:11525-191028879)x3	copy number gain	not provided [RCV000743147]	Chr4:11525..191028879 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
NM_021871.4(FGA):c.510+37C>T	single nucleotide variant	not provided [RCV001679926]	Chr4:154587475 [GRCh38] Chr4:155508627 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.*133G>A	single nucleotide variant	Congenital afibrinogenemia [RCV001148383]\|Familial visceral amyloidosis, Ostertag type [RCV001148384]	Chr4:154585361 [GRCh38] Chr4:155506513 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.1025G>A (p.Gly342Glu)	single nucleotide variant	Congenital afibrinogenemia [RCV001148494]\|Familial visceral amyloidosis, Ostertag type [RCV001148493]	Chr4:154586404 [GRCh38] Chr4:155507556 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.181-186T>C	single nucleotide variant	not provided [RCV001693192]	Chr4:154589162 [GRCh38] Chr4:155510314 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.780G>A (p.Glu260=)	single nucleotide variant	not provided [RCV000879648]	Chr4:154586649 [GRCh38] Chr4:155507801 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.811C>T (p.Arg271Ter)	single nucleotide variant	Congenital afibrinogenemia [RCV000984799]	Chr4:154586618 [GRCh38] Chr4:155507770 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.1103del (p.Gly368fs)	deletion	FGA-Related Disorders [RCV000779433]	Chr4:154586326 [GRCh38] Chr4:155507478 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.300G>A (p.Lys100=)	single nucleotide variant	Congenital afibrinogenemia [RCV001143942]\|Familial visceral amyloidosis, Ostertag type [RCV001143941]\|not provided [RCV000964974]	Chr4:154588857 [GRCh38] Chr4:155510009 [GRCh37] Chr4:4q31.3	benign\|likely benign
NM_021871.4(FGA):c.1155A>G (p.Gln385=)	single nucleotide variant	not provided [RCV000921628]	Chr4:154586274 [GRCh38] Chr4:155507426 [GRCh37] Chr4:4q31.3	likely benign
NM_021871.4(FGA):c.1366A>G (p.Thr456Ala)	single nucleotide variant	Abnormal bleeding [RCV001270514]\|Congenital afibrinogenemia [RCV001145722]\|Familial visceral amyloidosis, Ostertag type [RCV001145723]\|not provided [RCV000964973]	Chr4:154586063 [GRCh38] Chr4:155507215 [GRCh37] Chr4:4q31.3	benign\|likely benign\|uncertain significance
NM_021871.4(FGA):c.532C>T (p.Arg178Ter)	single nucleotide variant	FGA-Related Disorders [RCV000779434]	Chr4:154586897 [GRCh38] Chr4:155508049 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.187A>T (p.Lys63Ter)	single nucleotide variant	FGA-Related Disorders [RCV000779435]	Chr4:154588970 [GRCh38] Chr4:155510122 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.103C>A (p.Arg35Ser)	single nucleotide variant	Hypofibrinogenemia [RCV000851968]	Chr4:154589514 [GRCh38] Chr4:155510666 [GRCh37] Chr4:4q31.3	pathogenic
GRCh37/hg19 4q31.3-32.1(chr4:154907679-159012980)x1	copy number loss	not provided [RCV000848578]	Chr4:154907679..159012980 [GRCh37] Chr4:4q31.3-32.1	uncertain significance
NM_021871.4(FGA):c.1912G>A (p.Gly638Arg)	single nucleotide variant	Congenital afibrinogenemia [RCV001149944]\|Familial visceral amyloidosis, Ostertag type [RCV001149943]	Chr4:154585517 [GRCh38] Chr4:155506669 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.1207G>A (p.Ala403Thr)	single nucleotide variant	Congenital afibrinogenemia [RCV001145724]\|Familial visceral amyloidosis, Ostertag type [RCV001145725]	Chr4:154586222 [GRCh38] Chr4:155507374 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1918C>G (p.Pro640Ala)	single nucleotide variant	Congenital afibrinogenemia [RCV001149941]\|Familial visceral amyloidosis, Ostertag type [RCV001149942]	Chr4:154585511 [GRCh38] Chr4:155506663 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.1072G>A (p.Gly358Arg)	single nucleotide variant	Congenital afibrinogenemia [RCV001145727]\|Familial visceral amyloidosis, Ostertag type [RCV001145726]\|not provided [RCV001772340]	Chr4:154586357 [GRCh38] Chr4:155507509 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
GRCh37/hg19 4q31.3-35.2(chr4:151174061-190957473)x3	copy number gain	not provided [RCV000849098]	Chr4:151174061..190957473 [GRCh37] Chr4:4q31.3-35.2	pathogenic
NM_021871.4(FGA):c.104G>C (p.Arg35Pro)	single nucleotide variant	Hypofibrinogenemia [RCV000851972]	Chr4:154589513 [GRCh38] Chr4:155510665 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.327_337del (p.Met110fs)	deletion	not provided [RCV001008940]	Chr4:154588820..154588830 [GRCh38] Chr4:155509972..155509982 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.922C>T (p.Arg308Ter)	single nucleotide variant	Hypofibrinogenemia [RCV000852248]\|not provided [RCV001784377]	Chr4:154586507 [GRCh38] Chr4:155507659 [GRCh37] Chr4:4q31.3	pathogenic\|likely pathogenic
NM_021871.4(FGA):c.1621G>C (p.Val541Leu)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV000987481]	Chr4:154585808 [GRCh38] Chr4:155506960 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1718G>A (p.Arg573His)	single nucleotide variant	Congenital afibrinogenemia [RCV001145522]\|Familial visceral amyloidosis, Ostertag type [RCV001145521]	Chr4:154585711 [GRCh38] Chr4:155506863 [GRCh37] Chr4:4q31.3	benign\|uncertain significance
NM_021871.4(FGA):c.945del (p.Gly316fs)	deletion	Hypofibrinogenemia [RCV000851912]	Chr4:154586484 [GRCh38] Chr4:155507636 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.1472G>A (p.Cys491Tyr)	single nucleotide variant	Hypofibrinogenemia [RCV000852035]	Chr4:154585957 [GRCh38] Chr4:155507109 [GRCh37] Chr4:4q31.3	likely pathogenic
GRCh37/hg19 4q28.1-35.1(chr4:124873497-185278662)x3	copy number gain	not provided [RCV000849686]	Chr4:124873497..185278662 [GRCh37] Chr4:4q28.1-35.1	pathogenic
NM_021871.4(FGA):c.117del (p.Val40fs)	deletion	Familial dysfibrinogenemia [RCV002067219]\|Hypofibrinogenemia [RCV000852003]	Chr4:154589500 [GRCh38] Chr4:155510652 [GRCh37] Chr4:4q31.3	pathogenic\|likely pathogenic
NM_021871.4(FGA):c.365-144TTCT[15]	microsatellite	not provided [RCV001692768]	Chr4:154587745..154587746 [GRCh38] Chr4:155508897..155508898 [GRCh37] Chr4:4q31.3	benign
NM_000508.5(FGA):c.*328C>T	single nucleotide variant	not provided [RCV001661139]	Chr4:154583796 [GRCh38] Chr4:155504948 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.180+123G>A	single nucleotide variant	not provided [RCV001649511]	Chr4:154589314 [GRCh38] Chr4:155510466 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.1760C>G (p.Thr587Arg)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV000855410]	Chr4:154585669 [GRCh38] Chr4:155506821 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2244T>C (p.Ala748_Glu749=)	single nucleotide variant	not provided [RCV000886341]	Chr4:154584481 [GRCh38] Chr4:155505633 [GRCh37] Chr4:4q31.3	likely benign
NM_021871.4(FGA):c.1560C>T (p.Phe520=)	single nucleotide variant	not provided [RCV000933781]	Chr4:154585869 [GRCh38] Chr4:155507021 [GRCh37] Chr4:4q31.3	likely benign
NM_000508.5(FGA):c.2587del (p.Leu863_Val864insTer)	deletion	Familial visceral amyloidosis, Ostertag type [RCV000987480]	Chr4:154584138 [GRCh38] Chr4:155505290 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.365-144TTCT[11]	microsatellite	not provided [RCV001618816]	Chr4:154587746..154587757 [GRCh38] Chr4:155508898..155508909 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.1001G>A (p.Trp334Ter)	single nucleotide variant	not provided [RCV001530145]	Chr4:154586428 [GRCh38] Chr4:155507580 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.1113del (p.His372fs)	deletion	not provided [RCV001008260]	Chr4:154586316 [GRCh38] Chr4:155507468 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.181-148G>A	single nucleotide variant	not provided [RCV001599102]	Chr4:154589124 [GRCh38] Chr4:155510276 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.365-144TTCT[13]	microsatellite	not provided [RCV001671967]	Chr4:154587746..154587749 [GRCh38] Chr4:155508898..155508901 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.365-144TTCT[12]	microsatellite	not provided [RCV001665585]	Chr4:154587746..154587753 [GRCh38] Chr4:155508898..155508905 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.181-14C>T	single nucleotide variant	Congenital afibrinogenemia [RCV001145838]\|Familial visceral amyloidosis, Ostertag type [RCV001145837]	Chr4:154588990 [GRCh38] Chr4:155510142 [GRCh37] Chr4:4q31.3	benign\|likely benign
GRCh37/hg19 4q31.3-32.1(chr4:153061243-157994448)x1	copy number loss	not provided [RCV001005606]	Chr4:153061243..157994448 [GRCh37] Chr4:4q31.3-32.1	likely pathogenic
NM_021871.4(FGA):c.1615G>A (p.Glu539Lys)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV001200879]	Chr4:154585814 [GRCh38] Chr4:155506966 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.215G>A (p.Gly72Glu)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV001251021]	Chr4:154588942 [GRCh38] Chr4:155510094 [GRCh37] Chr4:4q31.3	uncertain significance
GRCh37/hg19 4q28.3-32.3(chr4:131303317-168722402)x3	copy number gain	not provided [RCV001537926]	Chr4:131303317..168722402 [GRCh37] Chr4:4q28.3-32.3	pathogenic
NM_021871.4(FGA):c.8C>T (p.Ser3Phe)	single nucleotide variant	not provided [RCV001338449]	Chr4:154590680 [GRCh38] Chr4:155511832 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2527T>C (p.Trp843Arg)	single nucleotide variant	Congenital afibrinogenemia [RCV001420403]	Chr4:154584198 [GRCh38] Chr4:155505350 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2372A>T (p.Asp791Val)	single nucleotide variant	Congenital afibrinogenemia [RCV001420404]	Chr4:154584353 [GRCh38] Chr4:155505505 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2155del (p.Gln719fs)	deletion	Congenital afibrinogenemia [RCV001420405]	Chr4:154584570 [GRCh38] Chr4:155505722 [GRCh37] Chr4:4q31.3	pathogenic
NM_000508.5(FGA):c.2128G>A (p.Gly710Ser)	single nucleotide variant	Congenital afibrinogenemia [RCV001420406]	Chr4:154584597 [GRCh38] Chr4:155505749 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2024T>G (p.Ile675Ser)	single nucleotide variant	Congenital afibrinogenemia [RCV001420407]	Chr4:154584701 [GRCh38] Chr4:155505853 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2024T>C (p.Ile675Thr)	single nucleotide variant	Congenital afibrinogenemia [RCV001420408]	Chr4:154584701 [GRCh38] Chr4:155505853 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2021T>C (p.Leu674Ser)	single nucleotide variant	Congenital afibrinogenemia [RCV001420409]	Chr4:154584704 [GRCh38] Chr4:155505856 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1930C>G (p.Pro644Ala)	single nucleotide variant	Congenital afibrinogenemia [RCV001420410]	Chr4:154585499 [GRCh38] Chr4:155506651 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1915A>G (p.Lys639Glu)	single nucleotide variant	Congenital afibrinogenemia [RCV001420411]	Chr4:154585514 [GRCh38] Chr4:155506666 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.181-96T>A	single nucleotide variant	not provided [RCV001675453]	Chr4:154589072 [GRCh38] Chr4:155510224 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.365-144TTCT[17]	microsatellite	not provided [RCV001695824]	Chr4:154587745..154587746 [GRCh38] Chr4:155508897..155508898 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.365-144TTCT[16]	microsatellite	not provided [RCV001614300]	Chr4:154587745..154587746 [GRCh38] Chr4:155508897..155508898 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.510+60G>A	single nucleotide variant	not provided [RCV001649635]	Chr4:154587452 [GRCh38] Chr4:155508604 [GRCh37] Chr4:4q31.3	benign
NM_021871.4(FGA):c.1470C>G (p.Asp490Glu)	single nucleotide variant	Congenital afibrinogenemia [RCV001420436]	Chr4:154585959 [GRCh38] Chr4:155507111 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1463G>A (p.Gly488Asp)	single nucleotide variant	Congenital afibrinogenemia [RCV001420437]	Chr4:154585966 [GRCh38] Chr4:155507118 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.829T>C (p.Tyr277His)	single nucleotide variant	Congenital afibrinogenemia [RCV001420438]	Chr4:154586600 [GRCh38] Chr4:155507752 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2113G>T (p.Gly705Ter)	single nucleotide variant	not specified [RCV002247834]	Chr4:154584612 [GRCh38] Chr4:155505764 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1486G>T (p.Asp496Tyr)	single nucleotide variant	Afibrinogenemia [RCV002245435]	Chr4:154585943 [GRCh38] Chr4:155507095 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1653del (p.Gly552fs)	deletion	not provided [RCV001783272]	Chr4:154585776 [GRCh38] Chr4:155506928 [GRCh37] Chr4:4q31.3	pathogenic
NM_000508.5(FGA):c.2414G>C (p.Gly805Ala)	single nucleotide variant	not provided [RCV001765692]	Chr4:154584311 [GRCh38] Chr4:155505463 [GRCh37] Chr4:4q31.3	uncertain significance
NM_000508.5(FGA):c.2350C>T (p.Gln784Ter)	single nucleotide variant	Familial visceral amyloidosis, Ostertag type [RCV001733514]	Chr4:154584375 [GRCh38] Chr4:155505527 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.364+1G>A	single nucleotide variant	not provided [RCV001783271]	Chr4:154588792 [GRCh38] Chr4:155509944 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.431_432del (p.Lys144fs)	deletion	Congenital afibrinogenemia [RCV002222072]\|not provided [RCV001756711]	Chr4:154587590..154587591 [GRCh38] Chr4:155508742..155508743 [GRCh37] Chr4:4q31.3	likely pathogenic\|uncertain significance
NM_021871.4(FGA):c.1690_1699dup (p.Ile567fs)	duplication	Familial visceral amyloidosis, Ostertag type [RCV001808895]	Chr4:154585729..154585730 [GRCh38] Chr4:155506881..155506882 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.1827del (p.Ser609fs)	deletion	not provided [RCV001815936]	Chr4:154585602 [GRCh38] Chr4:155506754 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.1406T>G (p.Val469Gly)	single nucleotide variant	not specified [RCV001822498]	Chr4:154586023 [GRCh38] Chr4:155507175 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.767A>C (p.Gln256Pro)	single nucleotide variant	not specified [RCV001822772]	Chr4:154586662 [GRCh38] Chr4:155507814 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1373G>A (p.Arg458His)	single nucleotide variant	not specified [RCV001822432]	Chr4:154586056 [GRCh38] Chr4:155507208 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1833C>T (p.Ala611=)	single nucleotide variant	not specified [RCV001822763]	Chr4:154585596 [GRCh38] Chr4:155506748 [GRCh37] Chr4:4q31.3	likely benign
NM_021871.4(FGA):c.718C>T (p.Gln240Ter)	single nucleotide variant	not provided [RCV002224183]	Chr4:154586711 [GRCh38] Chr4:155507863 [GRCh37] Chr4:4q31.3	pathogenic
NM_021871.4(FGA):c.154T>A (p.Trp52Arg)	single nucleotide variant	not provided [RCV002224683]	Chr4:154589463 [GRCh38] Chr4:155510615 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.1055del (p.Pro352fs)	deletion	Afibrinogenemia [RCV002245493]	Chr4:154586374 [GRCh38] Chr4:155507526 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.180+2_180+17del	deletion	not provided [RCV002224184]	Chr4:154589420..154589435 [GRCh38] Chr4:155510572..155510587 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.364+5G>A	single nucleotide variant	Congenital afibrinogenemia [RCV002222136]	Chr4:154588788 [GRCh38] Chr4:155509940 [GRCh37] Chr4:4q31.3	uncertain significance
NM_021871.4(FGA):c.103C>G (p.Arg35Gly)	single nucleotide variant	Afibrinogenemia [RCV002245494]	Chr4:154589514 [GRCh38] Chr4:155510666 [GRCh37] Chr4:4q31.3	likely pathogenic
NM_021871.4(FGA):c.448C>T (p.Gln150Ter)	single nucleotide variant	Familial dysfibrinogenemia [RCV002266520]	Chr4:154587574 [GRCh38] Chr4:155508726 [GRCh37] Chr4:4q31.3	pathogenic

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:3661	AgrOrtholog
COSMIC	FGA	COSMIC
Ensembl Genes	ENSG00000171560	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSP00000385981	ENTREZGENE
	ENSP00000385981.3	UniProtKB/Swiss-Prot
	ENSP00000498441	ENTREZGENE
	ENSP00000498441.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000403106	ENTREZGENE
	ENST00000403106.8	UniProtKB/Swiss-Prot
	ENST00000651975	ENTREZGENE
	ENST00000651975.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.215.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000171560	GTEx
HGNC ID	HGNC:3661	ENTREZGENE
Human Proteome Map	FGA	Human Proteome Map
InterPro	Fibrinogen-like_C	UniProtKB/Swiss-Prot
	Fibrinogen_a/b/g_C_1	UniProtKB/Swiss-Prot
	Fibrinogen_a/b/g_C_dom	UniProtKB/Swiss-Prot
	Fibrinogen_a/b/g_coil_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_aC	UniProtKB/Swiss-Prot
	Fibrinogen_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_CS	UniProtKB/Swiss-Prot
KEGG Report	hsa:2243	UniProtKB/Swiss-Prot
NCBI Gene	2243	ENTREZGENE
OMIM	105200	OMIM
	134820	OMIM
	202400	OMIM
	616004	OMIM
PANTHER	PTHR47221	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Fib_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_aC	UniProtKB/Swiss-Prot
	Fibrinogen_C	UniProtKB/Swiss-Prot
PharmGKB	PA429	PharmGKB
PROSITE	FIBRINOGEN_C_1	UniProtKB/Swiss-Prot
	FIBRINOGEN_C_2	UniProtKB/Swiss-Prot
SMART	FBG	UniProtKB/Swiss-Prot
	Fib_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56496	UniProtKB/Swiss-Prot
UniProt	A0A0S2Z3E8_HUMAN	UniProtKB/TrEMBL
	A0A0S2Z3E9_HUMAN	UniProtKB/TrEMBL
	A0A0S2Z3M3_HUMAN	UniProtKB/TrEMBL
	A0A0S2Z3P3_HUMAN	UniProtKB/TrEMBL
	FIBA_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q3KRA7_HUMAN	UniProtKB/TrEMBL
	Q6NSD8_HUMAN	UniProtKB/TrEMBL
	Q86Z09_HUMAN	UniProtKB/TrEMBL
	Q8WW76_HUMAN	UniProtKB/TrEMBL
	Q9UCH2	ENTREZGENE
UniProt Secondary	A8K3E4	UniProtKB/Swiss-Prot
	D3DP14	UniProtKB/Swiss-Prot
	D3DP15	UniProtKB/Swiss-Prot
	Q4QQH7	UniProtKB/Swiss-Prot
	Q9BX62	UniProtKB/Swiss-Prot
	Q9UCH2	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Manual Human Phenotype Annotations - RGD

Imported Human Phenotype Annotations - HPO

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Manual Human Phenotype Annotations - RGD

Imported Human Phenotype Annotations - HPO

Imported Human Phenotype Annotations - ClinVar