Nat1 (N-acetyl transferase 1) - Rat Genome Database

Name: Nat1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nat1 (N-acetyl transferase 1) Mus musculus

Analyze

Symbol:

Nat1

Name:

N-acetyl transferase 1

RGD ID:

735739

MGI Page

MGI

Description:

Exhibits arylamine N-acetyltransferase activity. Predicted to localize to cytosol. Is expressed in several structures, including adrenal gland; brain; genitourinary system; submandibular gland; and thymus. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); carcinoma (multiple); contact dermatitis (multiple); leukemia (multiple); and lung disease (multiple). Orthologous to human NAT1 (N-acetyltransferase 1) and NAT2 (N-acetyltransferase 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bifenthrin; biphenyl-4-amine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

arylamide acetylase 1; arylamine N-acetyltransferase 1; N(alpha)-acetyltransferase 15, NatA auxiliary subunit; N-acetyl transferase 1, liver, blood; N-acetyltransferase type 1; Nat; Nat-1

RGD Orthologs

Human

Rat

Bonobo

Pig

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NAT1 (N-acetyltransferase 1)	RGD	RGD
Rattus norvegicus (Norway rat):	Nat1 (N-acetyltransferase 1)	HGNC	OMA, HomoloGene, Panther, PhylomeDB, OrthoDB, Ensembl
Pan paniscus (bonobo/pygmy chimpanzee):	NAT1 (N-acetyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100511905 (arylamine N-acetyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	LOC103215401 (arylamine N-acetyltransferase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NAT2 (N-acetyltransferase 2)	HGNC	Ensembl, HGNC, HomoloGene, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Nat1 (N-acetyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Homo sapiens (human):	NAT2 (N-acetyltransferase 2)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	NAT1 (N-acetyltransferase 1)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|TreeFam)
Danio rerio (zebrafish):	si:dkey-78a14.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Danio rerio (zebrafish):	si:rp71-1f1.4	Alliance	DIOPT (OMA\|OrthoFinder\|TreeFam)
Danio rerio (zebrafish):	zgc:101040	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Danio rerio (zebrafish):	si:rp71-1f1.5	Alliance	DIOPT (OMA\|OrthoFinder\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

NCBI Annotation Information:

Note: Loci in other organisms that are functionally homologous to this one are validly referred to as both NAT1 and NAT2; i.e., the functional homologs of NAT1 include mouse and rat Nat2, while the functional homologs of human NAT2 include mouse and rat Nat1. Name:sequence associations are consistent with current use in the field. [13 Feb 2013]

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	67,943,620 - 67,945,183 (+)	NCBI	GRCm39		mm39
GRCm38	8	67,490,968 - 67,492,531 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	67,480,921 - 67,492,104 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	70,014,657 - 70,016,003 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	70,419,747 - 70,421,093 (+)	NCBI			mm8
Celera	8	70,044,212 - 70,045,558 (+)	NCBI		Celera
Cytogenetic Map	8	B3.2	NCBI
cM Map	8	33.38	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenocarcinoma (ISO)

allergic contact dermatitis (ISO)

Chromosome Aberrations (ISO)

disease of cellular proliferation (ISO)

Laryngeal Neoplasms (ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

occupational dermatitis (ISO)

pancreatic cancer (ISO)

prostate cancer (ISO)

Prostatic Neoplasms (ISO)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-cotinine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,4-dithiothreitol (ISO)

1,4-phenylenediamine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (ISO)

2-acetamidofluorene (ISO)

2-naphthylamine (ISO)

3,3'-Dimethylbenzidine (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-aminobenzoic acid (ISO)

4-aminosalicylic acid (ISO)

4-chloroaniline (ISO)

acetyl-CoA (ISO)

acetylsalicylic acid (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

Aloe emodin (ISO)

alpha-pinene (ISO)

ammonium chloride (ISO)

anilines (ISO)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

baicalein (ISO)

benzidine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bifenthrin (EXP)

biphenyl-4-amine (EXP,ISO)

bisphenol A (ISO)

butyric acid (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbamazepine (ISO)

carotenoid (ISO)

clofibric acid (ISO)

cobalt dichloride (ISO)

CU-O LINKAGE (ISO)

cyanamide (ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (ISO)

dehydroepiandrosterone sulfate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dihydrofolic acid (ISO)

diphenylmethane-4,4'-diisocyanate (ISO)

dorsomorphin (ISO)

endosulfan (ISO)

ethyl methanesulfonate (ISO)

flavonoids (ISO)

flutamide (ISO)

folic acid (ISO)

formaldehyde (ISO)

hexamethylene diisocyanate (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

L-1,4-dithiothreitol (ISO)

lead diacetate (EXP)

linsidomine (ISO)

mercury atom (ISO)

mercury dibromide (ISO)

mercury(0) (ISO)

mesalamine (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-hydroxy-2-acetamidofluorene (ISO)

N-hydroxy-4-acetylaminobiphenyl (ISO)

N-hydroxy-PhIP (ISO)

N-nitrosodiethylamine (EXP,ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

o-anisidine (ISO)

ozone (ISO)

p-anisidine (ISO)

p-chloromercuribenzoic acid (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

peroxynitrous acid (ISO)

phenylmercury acetate (ISO)

PhIP (ISO)

potassium chromate (ISO)

procainamide (ISO)

progesterone (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (ISO)

sulindac (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

titanium dioxide (EXP)

toluene 2,4-diisocyanate (ISO)

trichloroethene (ISO)

urethane (ISO)

valproic acid (ISO)

wogonin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aging (ISO)

liver development (ISO)

response to thyroxine (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

Molecular Function

acetyltransferase activity (IEA)

arylamine N-acetyltransferase activity (IBA,IDA,ISO)

transferase activity (IEA)

transferase activity, transferring acyl groups (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal enzyme/coenzyme activity (IAGP)

abnormal fasting circulating glucose level (IEA)

reduced fertility (IAGP)

References

References - curated


1.	Abdel-Rahman SZ, etal., Mutat Res. 1998 Feb 26;398(1-2):43-54.
2.	Bandmann O, etal., Lancet. 1997 Oct 18;350(9085):1136-9.
3.	Blomeke B, etal., Br J Dermatol. 2009 Nov;161(5):1130-5. doi: 10.1111/j.1365-2133.2009.09352.x. Epub 2009 Jun 11.
4.	Brocvielle H, etal., Skin Pharmacol Appl Skin Physiol. 2003 Nov-Dec;16(6):386-92.
5.	Dai Y, etal., Ind Health. 2009 Oct;47(5):479-86.
6.	Hein DW, etal., Environ Mol Mutagen. 2002;40(3):161-7.
7.	Jiao L, etal., Cancer Epidemiol Biomarkers Prev. 2007 Nov;16(11):2379-86.
8.	Majumder M, etal., Int J Cancer. 2007 May 15;120(10):2148-56.
9.	MGD and Homologene mouse data transfer
10.	MGD data from the GO Consortium
11.	MGD IEA
12.	OMIM Disease Annotation Pipeline
13.	Ozawa S, etal., Int J Cancer. 2002 Dec 1;102(4):418-21.
14.	Potts LF, etal., BMC Med Genet. 2012 Mar 17;13:16. doi: 10.1186/1471-2350-13-16.
15.	RGD automated import pipeline
16.	RGD automated import pipeline for gene-chemical interactions
17.	Suzuki H, etal., Carcinogenesis. 2008 Jun;29(6):1184-91. Epub 2008 May 21.
18.	Tamer L, etal., Clin Exp Dermatol. 2005 Jan;30(1):56-60.
19.	Tamer L, etal., Curr Eye Res. 2005 Oct;30(10):835-9.
20.	Unal M, etal., Laryngoscope. 2005 Dec;115(12):2238-41.
21.	Varzim G, etal., ORL J Otorhinolaryngol Relat Spec. 2002 May-Jun;64(3):206-12.
22.	Vatsis KP, etal., Pharmacogenetics 1995 Feb;5(1):1-17.
23.	von Schmiedeberg S, etal., Adv Exp Med Biol. 1999;455:147-52.
24.	Wikman H, etal., Pharmacogenetics. 2001 Mar;11(2):157-68.
25.	Zienolddiny S, etal., Carcinogenesis. 2008 Jun;29(6):1164-9. Epub 2008 Feb 6.

Additional References at PubMed

PMID:1513324	PMID:1875909	PMID:2227380	PMID:3209851	PMID:3941912	PMID:6976963	PMID:7545952	PMID:9070359	PMID:9839355	PMID:9929513	PMID:10640510	PMID:10862519
PMID:11060463	PMID:12054539	PMID:12142728	PMID:12477932	PMID:12815173	PMID:12888564	PMID:14681479	PMID:16098511	PMID:17403913	PMID:18373979	PMID:19090811	PMID:21267068
PMID:21347396	PMID:21873635	PMID:22193722	PMID:22644701	PMID:24067652	PMID:24194600	PMID:25432241	PMID:25798622	PMID:27626380	PMID:27705799	PMID:28003464	PMID:28700664
PMID:28888949	PMID:29237750	PMID:29447909	PMID:30883722

Genomics

Comparative Map Data

Nat1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	67,943,620 - 67,945,183 (+)	NCBI	GRCm39		mm39
GRCm38	8	67,490,968 - 67,492,531 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	67,480,921 - 67,492,104 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	70,014,657 - 70,016,003 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	70,419,747 - 70,421,093 (+)	NCBI			mm8
Celera	8	70,044,212 - 70,045,558 (+)	NCBI		Celera
Cytogenetic Map	8	B3.2	NCBI
cM Map	8	33.38	NCBI

NAT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	8	18,170,477 - 18,223,689 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	8	18,170,419 - 18,223,689 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	8	18,027,971 - 18,081,198 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	18,111,895 - 18,125,100 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	8	18,111,894 - 18,125,099	NCBI
Celera	8	17,033,182 - 17,047,129 (+)	NCBI
Cytogenetic Map	8	p22	NCBI
HuRef	8	16,572,274 - 16,625,520 (+)	NCBI		HuRef
CHM1_1	8	18,229,426 - 18,282,651 (+)	NCBI		CHM1_1

Nat1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	16	23,970,742 - 23,991,573 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	23,970,743 - 23,991,573 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	23,854,942 - 23,875,351 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	23,855,555 - 23,876,531 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	16	23,855,618 - 23,858,152 (-)	NCBI
Celera	16	22,352,492 - 22,372,774 (-)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

NAT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	8	14,339,766 - 14,393,216 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	14,386,481 - 14,392,462 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	8	17,425,852 - 17,439,684 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

LOC100511905
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	17	13,383,478 - 13,393,287 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	14,206,990 - 14,216,786 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103215401
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	16,302,296 - 16,315,406 (+)	NCBI
ChlSab1.1 Ensembl	8	16,314,446 - 16,315,318 (+)	Ensembl

Position Markers

U35885

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	67,491,920 - 67,492,023	UniSTS	GRCm38
MGSCv37	8	70,015,819 - 70,015,922	UniSTS	GRCm37
Celera	8	70,045,374 - 70,045,477	UniSTS
Cytogenetic Map	8	B3.1	UniSTS
Whitehead/MRC_RH	8	718.43	UniSTS

Nat1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
cM Map	8	31.0	UniSTS

UniSTS:492572

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	67,490,953 - 67,491,948	UniSTS	GRCm38
MGSCv37	8	70,014,852 - 70,015,847	UniSTS	GRCm37
Celera	8	70,044,407 - 70,045,402	UniSTS
Cytogenetic Map	8	B3.1	UniSTS

Nat1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	8	B3.1	UniSTS
cM Map	8	31.0	UniSTS

Nat1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	8	B3.1	UniSTS
cM Map	8	31.0	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
14747005	Mancz7_m	mandible centroid size 7 (mouse)					8	50053306	84053306	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37400000	109600000	Mouse
1301952	Im3_m	immunoregulatory 3 (mouse)			Not determined		8	54706614	88706763	Mouse
14700686	Civq3_m	cerebral infarct volume QTL 3 (mouse)					8	51882191	85882191	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	65357768	99357920	Mouse
1301544	Iba3_m	induction of brown adipocytes 3 (mouse)			Not determined		8	44294880	78295025	Mouse
1301441	Skull11_m	skull morphology 11 (mouse)			Not determined		8	47737134	81737254	Mouse
10766453	Char11_m	P. chabaudi malaria resistance QTL 11 (mouse)					8	47637030	81637146	Mouse
10412287	Carg3_m	Candida albicans resistance gene 3 (mouse)			Not determined		8	55545028	89545028	Mouse
14746987	Manh64_m	mandible shape 64 (mouse)					8	50053306	84053306	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	34642776	114837007	Mouse
1301936	Trigq2_m	triglyceride QTL 2 (mouse)			Not determined		8	33837362	67837502	Mouse
12904744	Carcdq1_m	cardiac collagen deposition QTL 1 (mouse)					8	39709256	94689598	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	63939547	97939696	Mouse
4140966	Egq12_m	early growth QTL 12 (mouse)			Not determined			32016544	71287993	Mouse
1558870	Eae36_m	experimental allergic encephalomyelitis susceptibility 36 (mouse)			Not determined		8	14723160	71045600	Mouse
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	65600207	99600347	Mouse
10043975	Obq31_m	obesity QTL 31 (mouse)			Not determined		8	58409776	92409776	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			63460107	97460107	Mouse
11353828	Gf7_m	gonadal fat pad weight 7 (mouse)					8	58201479	92201479	Mouse
4141437	W10q14_m	weight 10 weeks QTL 14 (mouse)			Not determined			32016544	71287993	Mouse
1301506	Aevm1_m	autoimmune extremity vasculitis in MRL mice 1 (mouse)			Not determined		8	54287817	88287993	Mouse
1301013	Capsq4_m	capsaicin sensitivity related QTL 4 (mouse)			Not determined		8	36163000	92728652	Mouse
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32016544	117238700	Mouse
1357715	Alaa3_m	alopecia areata 3 (mouse)			Not determined		8	48792939	82793021	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	60786850	94786976	Mouse
4141172	W6q9_m	weight 6 weeks QTL 9 (mouse)			Not determined			32016544	71287993	Mouse
1301717	Adip4_m	adiposity 4 (mouse)			Not determined		8	47637030	81637146	Mouse
1357811	Orq3_m	ovulation rate QTL 3 (mouse)			Not determined		8	32016544	71287993	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	44
Interacting mature miRNAs:	44
Transcripts:	ENSMUST00000026677
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_008673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ250123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ314650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ314651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ314652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ314653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ314654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC119181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC137747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U35885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U37119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000026677 ⟹ ENSMUSP00000026677

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	8	67,490,758 - 67,492,104 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000212171 ⟹ ENSMUSP00000148354

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	8	67,480,921 - 67,492,080 (+)	Ensembl

RefSeq Acc Id:

NM_008673 ⟹ NP_032699

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	67,943,620 - 67,945,183 (+)	NCBI
GRCm38	8	67,490,968 - 67,492,531 (+)	NCBI
MGSCv37	8	70,014,657 - 70,016,003 (+)	RGD
Celera	8	70,044,212 - 70,045,558 (+)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

GGGACCATGGACATCGAAGCATACTTTGAAAGGATTGGTTACAAGAACTCAGTGAATAAATTGG
ACTTAGCCACATTAACTGAAGTTCTTCAGCACCAGATGCGAGCAGTTCCTTTTGAGAATCTTAA
CATGCATTGTGGAGAAGCCATGCATCTGGATTTACAGGACATTTTTGACCACATAGTAAGGAAG
AAGAGAGGTGGATGGTGTCTCCAGGTTAATCATCTGCTGTACTGGGCTCTGACCAAAATGGGCT
TTGAAACCACAATGTTGGGAGGATATGTTTACATAACTCCAGTCAGCAAATATAGCAGTGAAAT
GGTCCACCTTCTAGTACAGGTGACCATCAGTGACAGGAAGTACATTGTGGATTCCGCCTATGGA
GGCTCCTACCAGATGTGGGAGCCTCTGGAATTAACATCTGGGAAGGATCAGCCTCAGGTGCCTG
CCATCTTCCTTTTGACAGAGGAGAATGGAACCTGGTACTTGGACCAAATCAGAAGAGAGCAGTA
TGTTCCAAATGAAGAATTTGTTAACTCAGACCTCCTTGAAAAGAACAAATATCGAAAAATCTAC
TCCTTTACTCTTGAGCCCCGAGTTATCGAGGATTTTGAATATGTGAATAGCTATCTTCAGACAT
CGCCAGCATCTGTGTTTGTAAGCACATCGTTCTGTTCCTTGCAGACCTCGGAAGGGGTTCACTG
TTTAGTGGGCTCCACCTTTACAAGTAGGAGATTCAGCTATAAGGACGATGTAGATCTGGTTGAG
TTTAAATATGTGAATGAGGAAGAAATAGAAGATGTACTGAAAACCGCATTTGGCATTTCTTTGG
AGAGAAAGTTTGTGCCCAAACATGGTGAACTAGTTTTTACTATTTAGGGTAAGGAGCAAAATTG
TTCTCCATTGTTATTTCATAGTCTTAAACCTTCTAAACATATGCAAATGTATCCATAACAGAAA
TCACCCAGTCCAATGCTGACCAACTAATGACTTGTTGTATCTTCTATTTCCTAGATTTTATAAA
ACGAAATCCTACTCCTCCTGTCATTTCACCAATAAAAATAGCGTCAGTTATACTTGAATAAAAT
AAATATATTAATGGATGTAACAACAATCCTTTCAATATTAATCAACAAAAATTACTTAATGAAG
ATGTGGAAATCTTTGGAGCCATATTGACTTGTAGTAGAAGCCTCCCACCATCATTTTATTGTTG
AACTCACATAAAAAGTGGTTGAATATGAATAATCAGAGAATAGCAGGTATAAAATTCAGCCAGA
ATAAATCTGATGTCCATGGTTTACAAGAAACCACATTCACAACTTAGGATCAGAATAAAGCAAA
GAAGAATGAGACATCATTTCAGATTCAGGTAACTTACCAGTCCTCAAAACAGAACTCAAGCCAG
TGCACCCGGGCTCTGTGAGTGGGTGCCAAGACAACGACATGGCTTAGAATTTCTTCCAGAGCTA
ATTGTGCAGACGTAGTTCCTTTTACATTGGATTTTTTTCAAACTATGAGAATACTTTAGAATTA
TGCAATTGATTTATACATTATATAATAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_032699	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA78942	(Get FASTA)	NCBI Sequence Viewer
	AAA80667	(Get FASTA)	NCBI Sequence Viewer
	AAI19182	(Get FASTA)	NCBI Sequence Viewer
	AAI37748	(Get FASTA)	NCBI Sequence Viewer
	CAC12844	(Get FASTA)	NCBI Sequence Viewer
	CAC85410	(Get FASTA)	NCBI Sequence Viewer
	CAC85411	(Get FASTA)	NCBI Sequence Viewer
	CAC85412	(Get FASTA)	NCBI Sequence Viewer
	CAC85413	(Get FASTA)	NCBI Sequence Viewer
	CAC85426	(Get FASTA)	NCBI Sequence Viewer
	EDL28704	(Get FASTA)	NCBI Sequence Viewer
	P50294	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_032699 ⟸ NM_008673

- UniProtKB:

P50294 (UniProtKB/Swiss-Prot), Q546L3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCGEAMHLDLQDIFDHIVRKKR
GGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSEMVHLLVQVTISDRKYIVDSAYGGS
YQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQIRREQYVPNEEFVNSDLLEKNKYRKIYSF
TLEPRVIEDFEYVNSYLQTSPASVFVSTSFCSLQTSEGVHCLVGSTFTSRRFSYKDDVDLVEFK
YVNEEEIEDVLKTAFGISLERKFVPKHGELVFTI

hide sequence

RefSeq Acc Id:

ENSMUSP00000026677 ⟸ ENSMUST00000026677

RefSeq Acc Id:

ENSMUSP00000148354 ⟸ ENSMUST00000212171

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97279	AgrOrtholog
Ensembl Genes	ENSMUSG00000025588	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000026677	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUSP00000148354	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000026677	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUST00000212171	UniProtKB/TrEMBL
InterPro	Arylamine_N-AcTrfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Papain-like_cys_pep_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:17960	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:97279	ENTREZGENE
NCBI Gene	17960	ENTREZGENE
PANTHER	PTHR11786	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Acetyltransf_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	NAT2	RGD
PhenoGen	Nat1	PhenoGen
PRINTS	ANATRNSFRASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54001	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniGene	Mm.14125	ENTREZGENE
UniProt	A0A1D5RLG2_MOUSE	UniProtKB/TrEMBL
	ARY1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q546L3	ENTREZGENE, UniProtKB/TrEMBL
	Q9ER94_MOUSE	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-27	Nat1	N-acetyl transferase 1	Nat1	N-acetyltransferase 1 (arylamine N-acetyltransferase)	Symbol and/or name change	5135510	APPROVED
2010-03-17	Nat1	N-acetyltransferase 1 (arylamine N-acetyltransferase)	Naa15	N(alpha)-acetyltransferase 15, NatA auxiliary subunit	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD