Advanced Search (OLGA)

Gene: MOS (MOS proto-oncogene, serine/threonine kinase) Homo sapiens

Analyze

Symbol:

MOS

Name:

MOS proto-oncogene, serine/threonine kinase

RGD ID:

735699

HGNC Page

HGNC:7199

Description:

Predicted to enable MAP kinase kinase kinase activity. Involved in oocyte maturation and positive regulation of ERK1 and ERK2 cascade. Located in cytoplasm.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

c-mos; MGC119962; MGC119963; MSV; oncogene MOS, Moloney murine sarcoma virus; oocyte maturation factor mos; OZEMA20; proto-oncogene c-Mos; proto-oncogene serine/threonine-protein kinase mos; v-mos Moloney murine sarcoma viral oncogene homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	56,112,942 - 56,113,982 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	56,112,942 - 56,113,982 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	57,025,501 - 57,026,541 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	57,188,055 - 57,189,095 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	57,188,054 - 57,189,095	NCBI
Celera	8	53,016,252 - 53,017,292 (-)	NCBI		Celera
Cytogenetic Map	8	q12.1	NCBI
HuRef	8	52,492,986 - 52,494,026 (-)	NCBI		HuRef
CHM1_1	8	57,077,104 - 57,078,144 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	56,489,918 - 56,490,958 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Female Infertility (IAGP)

Oocyte/Zygote/Embryo Maturation Arrest 20 (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-vinylcyclohexene dioxide (ISO)

6-propyl-2-thiouracil (ISO)

aflatoxin B1 (EXP)

ammonium chloride (ISO)

arsenite(3-) (EXP)

atrazine (EXP)

benzo[a]pyrene (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

cadmium atom (EXP)

cadmium dichloride (EXP,ISO)

caffeine (EXP)

cisplatin (EXP)

dioxygen (EXP)

flavonoids (ISO)

fulvestrant (EXP)

lead diacetate (ISO)

methoxychlor (ISO)

quercetin (EXP)

resveratrol (EXP)

simazine (ISO)

Theaflavin 3,3'-digallate (EXP)

tipifarnib (ISO)

trichloroethene (ISO)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to cAMP (ISO)

cellular response to nerve growth factor stimulus (ISO)

chromatin organization (IEA,ISS)

ERK1 and ERK2 cascade (ISO)

establishment of meiotic spindle orientation (IEA,ISS)

MAPK cascade (ISS)

meiotic cell cycle process involved in oocyte maturation (ISO)

meiotic spindle organization (IEA,ISS)

negative regulation of metaphase/anaphase transition of meiotic cell cycle (IBA,IEA,ISS)

oocyte maturation (IMP)

positive regulation of ERK1 and ERK2 cascade (IDA)

positive regulation of MAPK cascade (IBA,IEA,ISS)

positive regulation of myoblast differentiation (ISO)

regulation of meiotic nuclear division (IEA)

signal transduction (IBA)

skeletal muscle tissue development (ISO)

spermatocyte division (ISO)

Cellular Component

cytoplasm (IBA,IEA,IMP)

cytosol (ISO)

Molecular Function

ATP binding (IEA)

kinase activity (IEA)

MAP kinase kinase kinase activity (ISS)

MRF binding (ISO)

nucleotide binding (IEA)

protein binding (IPI)

protein kinase activity (IBA,IEA)

protein serine kinase activity (IEA,ISO)

protein serine/threonine kinase activity (IEA,ISS)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

mitogen activated protein kinase signaling pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Amenorrhea (IAGP)

Autosomal recessive inheritance (IAGP)

Female infertility (IAGP)

Young adult onset (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Biallelic mutations in MOS cause female infertility characterized by human early embryonic arrest and fragmentation.	Zhang YL, etal., EMBO Mol Med. 2021 Dec 7;13(12):e14887. doi: 10.15252/emmm.202114887. Epub 2021 Nov 15.

Additional References at PubMed

PMID:3000766	PMID:6287464	PMID:7540181	PMID:9001211	PMID:9008413	PMID:9552420	PMID:10376524	PMID:10439036	PMID:11180847	PMID:12022922	PMID:12477932	PMID:15188402
PMID:15341746	PMID:15489334	PMID:16401344	PMID:17207965	PMID:17410130	PMID:17474147	PMID:18187620	PMID:18246541	PMID:18391951	PMID:18550795	PMID:20186124	PMID:20546612
PMID:21516116	PMID:21873635	PMID:22252584	PMID:22939624	PMID:23595635	PMID:24163370	PMID:25036637	PMID:25416956	PMID:25512530	PMID:26186194	PMID:26598620	PMID:28514442
PMID:29892012	PMID:30415952	PMID:30886144	PMID:31515488	PMID:31586073	PMID:31952546	PMID:32296183	PMID:32707033	PMID:33961781	PMID:34997960	PMID:35156780	PMID:35670744
PMID:36403623

Genomics

Comparative Map Data

MOS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	56,112,942 - 56,113,982 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	56,112,942 - 56,113,982 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	57,025,501 - 57,026,541 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	57,188,055 - 57,189,095 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	57,188,054 - 57,189,095	NCBI
Celera	8	53,016,252 - 53,017,292 (-)	NCBI		Celera
Cytogenetic Map	8	q12.1	NCBI
HuRef	8	52,492,986 - 52,494,026 (-)	NCBI		HuRef
CHM1_1	8	57,077,104 - 57,078,144 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	56,489,918 - 56,490,958 (-)	NCBI		T2T-CHM13v2.0

Mos
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	3,870,658 - 3,872,105 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	3,870,657 - 3,872,105 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	3,870,658 - 3,872,105 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	3,870,657 - 3,872,105 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	3,797,805 - 3,799,252 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	3,797,930 - 3,799,104 (-)	NCBI		MGSCv36	mm8
Celera	4	3,827,056 - 3,828,607 (-)	NCBI		Celera
Cytogenetic Map	4	A1	NCBI
cM Map	4	2.16	NCBI

Mos
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	21,657,549 - 21,658,856 (-)	NCBI		GRCr8
mRatBN7.2	5	16,859,957 - 16,861,264 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	16,859,957 - 16,861,264 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	19,101,026 - 19,102,333 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	20,699,515 - 20,700,822 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	20,451,008 - 20,452,315 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	16,746,085 - 16,747,392 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	16,746,197 - 16,747,222 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	21,526,047 - 21,527,345 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	17,158,906 - 17,160,204 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	17,157,660 - 17,160,891 (-)	NCBI
Celera	5	16,224,269 - 16,225,576 (-)	NCBI		Celera
Cytogenetic Map	5	q12	NCBI

Mos
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955454	15,193,132 - 15,194,268 (-)	NCBI	ChiLan1.0	ChiLan1.0

MOS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	71,770,387 - 71,771,734 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	47,494,891 - 47,496,185 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	52,559,066 - 52,560,362 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	49,930,077 - 49,931,117 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	49,930,077 - 49,931,117 (-)	Ensembl	panpan1.1		panPan2

MOS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	7,510,987 - 7,513,180 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	7,823,723 - 7,826,339 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	7,585,329 - 7,589,193 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	7,585,443 - 7,586,489 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	7,599,834 - 7,602,449 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	7,731,622 - 7,735,488 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	8,008,489 - 8,012,354 (-)	NCBI		UU_Cfam_GSD_1.0

Mos
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	72,020,606 - 72,021,655 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936496	2,763,822 - 2,764,871 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936496	2,763,822 - 2,764,871 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MOS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	75,739,402 - 75,741,076 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	75,739,402 - 75,741,076 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	82,657,132 - 82,658,806 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MOS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	52,150,113 - 52,152,390 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	52,150,237 - 52,151,274 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	89,647,409 - 89,648,911 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mos
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624886	3,934,192 - 3,935,220 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624886	3,934,081 - 3,935,341 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in MOS
34 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 8p23.3-q24.3(chr8:241530-145049449)x3	copy number gain	See cases [RCV000051206]	Chr8:241530..145049449 [GRCh38] Chr8:191530..146274835 [GRCh37] Chr8:181530..146245639 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241530-145054634)x3	copy number gain	See cases [RCV000053602]	Chr8:241530..145054634 [GRCh38] Chr8:191530..146280020 [GRCh37] Chr8:181530..146250824 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:244417-145054775)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053604]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053604]\|See cases [RCV000053604]	Chr8:244417..145054775 [GRCh38] Chr8:194417..146280161 [GRCh37] Chr8:184417..146250965 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh38/hg38 8q12.1(chr8:55423413-58836753)x1	copy number loss	See cases [RCV000054240]	Chr8:55423413..58836753 [GRCh38] Chr8:56335973..59749312 [GRCh37] Chr8:56498527..59911866 [NCBI36] Chr8:8q12.1	pathogenic
GRCh38/hg38 8q11.1-13.2(chr8:46031334-69303787)x3	copy number gain	See cases [RCV000133720]	Chr8:46031334..69303787 [GRCh38] Chr8:46942956..70216022 [GRCh37] Chr8:47062121..70378576 [NCBI36] Chr8:8q11.1-13.2	pathogenic
GRCh38/hg38 8q11.23-12.1(chr8:53996579-56163431)x1	copy number loss	See cases [RCV000135764]	Chr8:53996579..56163431 [GRCh38] Chr8:54909139..57075990 [GRCh37] Chr8:55071692..57238544 [NCBI36] Chr8:8q11.23-12.1	likely pathogenic
GRCh38/hg38 8q12.1-12.3(chr8:55315854-64952752)x3	copy number gain	See cases [RCV000137672]	Chr8:55315854..64952752 [GRCh38] Chr8:56228414..65864987 [GRCh37] Chr8:56390968..66027541 [NCBI36] Chr8:8q12.1-12.3	pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241605-145054781)x3	copy number gain	See cases [RCV000138643]	Chr8:241605..145054781 [GRCh38] Chr8:191605..146280167 [GRCh37] Chr8:181605..146250971 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh38/hg38 8q11.1-24.3(chr8:46031340-139285494)x3	copy number gain	See cases [RCV000139539]	Chr8:46031340..139285494 [GRCh38] Chr8:46942962..140297737 [GRCh37] Chr8:47062127..140366919 [NCBI36] Chr8:8q11.1-24.3	pathogenic
GRCh38/hg38 8p12-q12.1(chr8:36580103-59618998)x3	copy number gain	See cases [RCV000139582]	Chr8:36580103..59618998 [GRCh38] Chr8:36437621..60531557 [GRCh37] Chr8:36556779..60694111 [NCBI36] Chr8:8p12-q12.1	pathogenic
GRCh38/hg38 8q12.1-12.2(chr8:54821357-61146302)x1	copy number loss	See cases [RCV000140643]	Chr8:54821357..61146302 [GRCh38] Chr8:55733917..62058861 [GRCh37] Chr8:55896471..62221415 [NCBI36] Chr8:8q12.1-12.2	pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:208048-145070385)x3	copy number gain	See cases [RCV000141808]	Chr8:208048..145070385 [GRCh38] Chr8:158048..146295771 [GRCh37] Chr8:148048..146266575 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh38/hg38 8p21.3-q24.3(chr8:21291522-145070385)x3	copy number gain	See cases [RCV000142021]	Chr8:21291522..145070385 [GRCh38] Chr8:21149033..146295771 [GRCh37] Chr8:21193313..146266575 [NCBI36] Chr8:8p21.3-q24.3	pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:226452-145068712)x3	copy number gain	See cases [RCV000142858]	Chr8:226452..145068712 [GRCh38] Chr8:176452..146294098 [GRCh37] Chr8:166452..146264902 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh38/hg38 8q12.1(chr8:54764950-56785299)x1	copy number loss	See cases [RCV000142992]	Chr8:54764950..56785299 [GRCh38] Chr8:55677510..57697858 [GRCh37] Chr8:55840064..57860412 [NCBI36] Chr8:8q12.1	pathogenic
GRCh38/hg38 8q11.21-12.1(chr8:49471778-57825470)x1	copy number loss	See cases [RCV000142642]	Chr8:49471778..57825470 [GRCh38] Chr8:50384337..58738029 [GRCh37] Chr8:50546890..58900583 [NCBI36] Chr8:8q11.21-12.1	pathogenic\|likely pathogenic
GRCh38/hg38 8q11.23-12.3(chr8:53325389-61863018)x1	copy number loss	See cases [RCV000143182]	Chr8:53325389..61863018 [GRCh38] Chr8:54237949..62775577 [GRCh37] Chr8:54400502..62938131 [NCBI36] Chr8:8q11.23-12.3	pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241530-145054634)x3	copy number gain	See cases [RCV000148092]	Chr8:241530..145054634 [GRCh38] Chr8:191530..146280020 [GRCh37] Chr8:181530..146250824 [NCBI36] Chr8:8p23.3-q24.3	pathogenic
GRCh37/hg19 8q11.23-12.3(chr8:53436131-65195953)x3	copy number gain	See cases [RCV000239428]	Chr8:53436131..65195953 [GRCh37] Chr8:8q11.23-12.3	pathogenic
GRCh37/hg19 8q12.1(chr8:56405320-57358911)x1	copy number loss	See cases [RCV000240504]	Chr8:56405320..57358911 [GRCh37] Chr8:8q12.1	likely pathogenic
GRCh37/hg19 8q12.1(chr8:56806172-57128944)x3	copy number gain	See cases [RCV000446388]	Chr8:56806172..57128944 [GRCh37] Chr8:8q12.1	likely benign
GRCh37/hg19 8p23.3-q24.3(chr8:158991-146280828)x3	copy number gain	See cases [RCV000447507]	Chr8:158991..146280828 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
GRCh37/hg19 8q11.23-12.1(chr8:54661151-57790737)x3	copy number gain	See cases [RCV000445710]	Chr8:54661151..57790737 [GRCh37] Chr8:8q11.23-12.1	uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:158049-146295771)	copy number gain	See cases [RCV000510234]	Chr8:158049..146295771 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:158049-146295771)x3	copy number gain	See cases [RCV000511095]	Chr8:158049..146295771 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
NM_005372.1(MOS):c.299G>A (p.Arg100Gln)	single nucleotide variant	not specified [RCV004328513]	Chr8:56113684 [GRCh38] Chr8:57026243 [GRCh37] Chr8:8q12.1	likely benign
GRCh37/hg19 8p23.1-q24.3(chr8:12490999-146295771)x3	copy number gain	See cases [RCV000512169]	Chr8:12490999..146295771 [GRCh37] Chr8:8p23.1-q24.3	pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:164984-146293414)x3	copy number gain	not provided [RCV000747254]	Chr8:164984..146293414 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:10213-146293414)x3	copy number gain	not provided [RCV000747248]	Chr8:10213..146293414 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
GRCh37/hg19 8q11.21-12.1(chr8:49822483-58822602)x1	copy number loss	not provided [RCV000747540]	Chr8:49822483..58822602 [GRCh37] Chr8:8q11.21-12.1	pathogenic
GRCh37/hg19 8p11.22-q12.3(chr8:39555657-64049089)x3	copy number gain	not provided [RCV000846266]	Chr8:39555657..64049089 [GRCh37] Chr8:8p11.22-q12.3	pathogenic
GRCh37/hg19 8p12-q24.3(chr8:31936551-146295771)x3	copy number gain	not provided [RCV000848192]	Chr8:31936551..146295771 [GRCh37] Chr8:8p12-q24.3	pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:158048-146295771)x3	copy number gain	not provided [RCV000848478]	Chr8:158048..146295771 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
NM_005372.1(MOS):c.146G>T (p.Arg49Leu)	single nucleotide variant	not specified [RCV004290833]	Chr8:56113837 [GRCh38] Chr8:57026396 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.349A>G (p.Ile117Val)	single nucleotide variant	not provided [RCV004809389]	Chr8:56113634 [GRCh38] Chr8:57026193 [GRCh37] Chr8:8q12.1	uncertain significance
NC_000008.10:g.(?_56854419)_(57906144_?)dup	duplication	not provided [RCV002020622]	Chr8:56854419..57906144 [GRCh37] Chr8:8q12.1	uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:158048-146295771)	copy number gain	Polydactyly [RCV002280629]	Chr8:158048..146295771 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
NM_005372.1(MOS):c.1019C>G (p.Ser340Cys)	single nucleotide variant	not specified [RCV004170210]	Chr8:56112964 [GRCh38] Chr8:57025523 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.972C>T (p.Ser324=)	single nucleotide variant	not provided [RCV002512357]	Chr8:56113011 [GRCh38] Chr8:57025570 [GRCh37] Chr8:8q12.1	likely benign
NM_005372.1(MOS):c.124C>T (p.Arg42Trp)	single nucleotide variant	not specified [RCV004072734]	Chr8:56113859 [GRCh38] Chr8:57026418 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.531G>T (p.Lys177Asn)	single nucleotide variant	not specified [RCV004175687]	Chr8:56113452 [GRCh38] Chr8:57026011 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.1010A>C (p.Asp337Ala)	single nucleotide variant	not specified [RCV004132301]	Chr8:56112973 [GRCh38] Chr8:57025532 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.830C>A (p.Ala277Glu)	single nucleotide variant	not specified [RCV004194298]	Chr8:56113153 [GRCh38] Chr8:57025712 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.929G>A (p.Gly310Glu)	single nucleotide variant	not specified [RCV004140164]	Chr8:56113054 [GRCh38] Chr8:57025613 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.416T>C (p.Met139Thr)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228745]	Chr8:56113567 [GRCh38] Chr8:57026126 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.960C>A (p.Cys320Ter)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228748]	Chr8:56113023 [GRCh38] Chr8:57025582 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.596A>T (p.His199Leu)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228752]	Chr8:56113387 [GRCh38] Chr8:57025946 [GRCh37] Chr8:8q12.1	pathogenic\|uncertain significance
NM_005372.1(MOS):c.737G>A (p.Arg246His)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228746]	Chr8:56113246 [GRCh38] Chr8:57025805 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.701C>A (p.Thr234Lys)	single nucleotide variant	not specified [RCV004279994]	Chr8:56113282 [GRCh38] Chr8:57025841 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.539A>C (p.Lys180Thr)	single nucleotide variant	not specified [RCV004270544]	Chr8:56113444 [GRCh38] Chr8:57026003 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.467del (p.Gly156fs)	deletion	Oocyte/zygote/embryo maturation arrest 20 [RCV003228749]	Chr8:56113516 [GRCh38] Chr8:57026075 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.956G>A (p.Arg319His)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228750]	Chr8:56113027 [GRCh38] Chr8:57025586 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.791C>G (p.Ser264Cys)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228751]	Chr8:56113192 [GRCh38] Chr8:57025751 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.285C>A (p.Asn95Lys)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228744]	Chr8:56113698 [GRCh38] Chr8:57026257 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.875C>T (p.Ala292Val)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228747]	Chr8:56113108 [GRCh38] Chr8:57025667 [GRCh37] Chr8:8q12.1	pathogenic\|uncertain significance
NM_005372.1(MOS):c.591T>G (p.Ile197Met)	single nucleotide variant	Oocyte/zygote/embryo maturation arrest 20 [RCV003228753]	Chr8:56113392 [GRCh38] Chr8:57025951 [GRCh37] Chr8:8q12.1	pathogenic
NM_005372.1(MOS):c.366T>A (p.Ala122=)	single nucleotide variant	not provided [RCV003423925]	Chr8:56113617 [GRCh38] Chr8:57026176 [GRCh37] Chr8:8q12.1	likely benign
GRCh37/hg19 8p21.2-q21.3(chr8:27024288-89410121)x3	copy number gain	not specified [RCV003986754]	Chr8:27024288..89410121 [GRCh37] Chr8:8p21.2-q21.3	pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:158048-146295771)x3	copy number gain	not specified [RCV003986742]	Chr8:158048..146295771 [GRCh37] Chr8:8p23.3-q24.3	pathogenic
NM_005372.1(MOS):c.982A>G (p.Arg328Gly)	single nucleotide variant	not specified [RCV004495420]	Chr8:56113001 [GRCh38] Chr8:57025560 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.35G>T (p.Arg12Leu)	single nucleotide variant	not specified [RCV004643365]	Chr8:56113948 [GRCh38] Chr8:57026507 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.460G>A (p.Ala154Thr)	single nucleotide variant	not specified [RCV004629066]	Chr8:56113523 [GRCh38] Chr8:57026082 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.959G>T (p.Cys320Phe)	single nucleotide variant	not specified [RCV004629068]	Chr8:56113024 [GRCh38] Chr8:57025583 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.859C>G (p.Leu287Val)	single nucleotide variant	not specified [RCV004643367]	Chr8:56113124 [GRCh38] Chr8:57025683 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.218C>T (p.Ser73Leu)	single nucleotide variant	not specified [RCV004643366]	Chr8:56113765 [GRCh38] Chr8:57026324 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.736C>A (p.Arg246Ser)	single nucleotide variant	not specified [RCV004824686]	Chr8:56113247 [GRCh38] Chr8:57025806 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.731C>A (p.Thr244Asn)	single nucleotide variant	not specified [RCV004828395]	Chr8:56113252 [GRCh38] Chr8:57025811 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.53C>T (p.Ser18Leu)	single nucleotide variant	not specified [RCV004828396]	Chr8:56113930 [GRCh38] Chr8:57026489 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.743C>T (p.Pro248Leu)	single nucleotide variant	not specified [RCV004824687]	Chr8:56113240 [GRCh38] Chr8:57025799 [GRCh37] Chr8:8q12.1	uncertain significance
NM_005372.1(MOS):c.470A>G (p.His157Arg)	single nucleotide variant	not specified [RCV004828397]	Chr8:56113513 [GRCh38] Chr8:57026072 [GRCh37] Chr8:8q12.1	uncertain significance

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	40
Interacting mature miRNAs:	40
Transcripts:	ENST00000311923
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300005	BP49_H	Blood pressure QTL 49 (human)	2.24	0.00066	Blood pressure	systolic	8	53177420	79177420	Human
2289597	BW470_H	Body weight QTL 470 (human)	1.3		Body weight	BMI	8	39770887	65770887	Human

Markers in Region

RH17579

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	8	57,025,679 - 57,025,884	UniSTS	GRCh37
Build 36	8	57,188,233 - 57,188,438	RGD	NCBI36
Celera	8	53,016,430 - 53,016,635	RGD
Cytogenetic Map	8	q11	UniSTS
HuRef	8	52,493,164 - 52,493,369	UniSTS
GeneMap99-GB4 RH Map	8	314.95	UniSTS
NCBI RH Map	8	785.4	UniSTS

GDB:386777

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	8	57,026,024 - 57,026,226	UniSTS	GRCh37
Build 36	8	57,188,578 - 57,188,780	RGD	NCBI36
Celera	8	53,016,775 - 53,016,977	RGD
Cytogenetic Map	8	q11	UniSTS
HuRef	8	52,493,509 - 52,493,711	UniSTS

MOS__6333

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	8	57,025,404 - 57,026,287	UniSTS	GRCh37
Build 36	8	57,187,958 - 57,188,841	RGD	NCBI36
Celera	8	53,016,155 - 53,017,038	RGD
HuRef	8	52,492,889 - 52,493,772	UniSTS

MOS

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	8	57,026,218 - 57,026,374	UniSTS	GRCh37
Build 36	8	57,188,772 - 57,188,928	RGD	NCBI36
Celera	8	53,016,969 - 53,017,125	RGD
HuRef	8	52,493,703 - 52,493,859	UniSTS

UniSTS:481735

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	8	57,025,501 - 57,026,541	UniSTS	GRCh37
Celera	8	53,016,252 - 53,017,292	UniSTS
HuRef	8	52,492,986 - 52,494,026	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
99	248	218	139	1635	132	160	20	134	13	312	474	487	9	1430	51	543	128	7

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_005372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069590	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC106737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC106738	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000311923 ⟹ ENSP00000310722

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	8	56,112,942 - 56,113,982 (-)	Ensembl

RefSeq Acc Id:

NM_005372 ⟹ NP_005363

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	8	56,112,942 - 56,113,982 (-)	NCBI
GRCh37	8	57,025,501 - 57,026,541 (-)	ENTREZGENE
Build 36	8	57,188,055 - 57,189,095 (-)	NCBI Archive
HuRef	8	52,492,986 - 52,494,026 (-)	ENTREZGENE
CHM1_1	8	57,077,104 - 57,078,144 (-)	NCBI
T2T-CHM13v2.0	8	56,489,918 - 56,490,958 (-)	NCBI

Sequence:

show sequence

ATGCCCTCGCCCCTGGCCCTACGCCCCTACCTCCGGAGCGAGTTTTCCCCATCGGTGGACGCGC
GGCCCTGCAGCAGTCCCTCAGAGCTACCTGCGAAGCTGCTTCTGGGGGCCACTCTTCCTCGGGC
CCCGCGGCTGCCGCGCCGGCTGGCCTGGTGCTCCATTGACTGGGAGCAGGTGTGCTTGCTGCAG
AGGCTGGGAGCTGGAGGGTTTGGCTCGGTGTACAAGGCGACTTACCGCGGTGTTCCTGTGGCCA
TAAAGCAAGTGAACAAGTGCACCAAGAACCGACTAGCATCTCGGCGGAGTTTCTGGGCTGAGCT
CAACGTAGCAAGGCTGCGCCACGATAACATCGTGCGCGTGGTGGCTGCCAGCACGCGCACGCCC
GCAGGGTCCAATAGCCTAGGGACCATCATCATGGAGTTCGGTGGCAACGTCACTTTACACCAAG
TCATCTATGGCGCCGCCGGCCACCCTGAGGGGGACGCAGGGGAGCCTCACTGCCGCACTGGAGG
ACAGTTAAGTTTGGGAAAGTGTCTCAAGTACTCACTAGATGTTGTGAACGGCCTGCTCTTCCTC
CACTCGCAAAGCATTGTGCACTTGGACCTGAAGCCCGCGAACATCTTGATCAGTGAGCAGGATG
TCTGTAAAATTAGTGACTTCGGTTGCTCTGAGAAGTTGGAAGATCTGCTGTGCTTCCAGACACC
CTCTTACCCTCTAGGAGGCACATACACCCACCGCGCCCCGGAGCTCCTGAAAGGAGAGGGCGTG
ACGCCTAAAGCCGACATTTATTCCTTTGCCATCACTCTCTGGCAAATGACTACCAAGCAGGCGC
CGTATTCGGGGGAGCGGCAGCACATACTGTACGCGGTGGTGGCCTACGACCTGCGCCCGTCCCT
CTCCGCTGCCGTCTTCGAGGACTCGCTCCCCGGGCAGCGCCTTGGGGACGTCATCCAGCGCTGC
TGGAGACCCAGCGCGGCGCAGAGGCCGAGCGCGCGGCTGCTTTTGGTGGATCTCACCTCTTTGA
AAGCTGAACTCGGCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_005363	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA52029	(Get FASTA)	NCBI Sequence Viewer
	AAH69569	(Get FASTA)	NCBI Sequence Viewer
	AAH69590	(Get FASTA)	NCBI Sequence Viewer
	AAI06738	(Get FASTA)	NCBI Sequence Viewer
	AAI06739	(Get FASTA)	NCBI Sequence Viewer
	EAW86773	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000310722
	ENSP00000310722.1
GenBank Protein	P00540	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_005363 ⟸ NM_005372

- UniProtKB:

Q3KPG9 (UniProtKB/Swiss-Prot), Q3KPH0 (UniProtKB/Swiss-Prot), P00540 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQ
RLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTP
AGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFL
HSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGV
TPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRC
WRPSAAQRPSARLLLVDLTSLKAELG

hide sequence

Ensembl Acc Id:

ENSP00000310722 ⟸ ENST00000311923

Protein Domains

Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P00540-F1-model_v2	AlphaFold	P00540	1-346	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:7199	AgrOrtholog
COSMIC	MOS	COSMIC
Ensembl Genes	ENSG00000172680	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000311923	ENTREZGENE
	ENST00000311923.1	UniProtKB/Swiss-Prot
Gene3D-CATH	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
GTEx	ENSG00000172680	GTEx
HGNC ID	HGNC:7199	ENTREZGENE
Human Proteome Map	MOS	Human Proteome Map
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
	Ser/Thr_Kinases-Pseudokinases	UniProtKB/Swiss-Prot
KEGG Report	hsa:4342	UniProtKB/Swiss-Prot
NCBI Gene	4342	ENTREZGENE
OMIM	190060	OMIM
PANTHER	SERINE/THREONINE-PROTEIN KINASE TNNI3K-RELATED	UniProtKB/Swiss-Prot
	V-MOS MOLONEY MURINE SARCOMA VIRAL ONCO HOMOLOG	UniProtKB/Swiss-Prot
Pfam	Pkinase	UniProtKB/Swiss-Prot
PharmGKB	PA30907	PharmGKB
PIRSF	Integrin-linked_kinase	UniProtKB/Swiss-Prot
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
SMART	S_TKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot
UniProt	MOS_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q3KPG9	ENTREZGENE
	Q3KPH0	ENTREZGENE
UniProt Secondary	Q3KPG9	UniProtKB/Swiss-Prot
	Q3KPH0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-12-13	MOS	MOS proto-oncogene, serine/threonine kinase	MOS	v-mos Moloney murine sarcoma viral oncogene homolog	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - HPO

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - HPO