Rpl7 (ribosomal protein L7) - Rat Genome Database

Name: Rpl7
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rpl7 (ribosomal protein L7) Rattus norvegicus

Analyze

Symbol:

Rpl7

Name:

ribosomal protein L7

RGD ID:

735169

Description:

Enables 5S rRNA binding activity. Involved in liver regeneration. Located in A band and ribosome. Part of cytosolic large ribosomal subunit. Orthologous to human RPL7 (ribosomal protein L7); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

60S ribosomal protein L7

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL7 (ribosomal protein L7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rpl7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl7 (ribosomal protein L7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Rpl7 (ribosomal protein L7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RPL7 (ribosomal protein L7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	rpl7 (ribosomal protein L7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL7A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL7B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Rpl7-ps15 Rpl7-ps3

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	3,217,184 - 3,220,192 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	5	5,334,591 - 5,337,603 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	6,973,456 - 6,976,468 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	6,670,423 - 6,673,424 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	2,633,517 - 2,636,525 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	2,632,712 - 2,640,021 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	2,621,855 - 2,624,863 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	2,315,766 - 2,318,774 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	2,315,744 - 2,318,414 (+)	NCBI
Celera	5	2,818,341 - 2,821,349 (+)	NCBI		Celera
Cytogenetic Map	5	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3'-diindolylmethane (ISO)

aconitine (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

artesunate (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

hydralazine (ISO)

hydrogen peroxide (ISO)

hydrogen sulfide (ISO)

ivermectin (ISO)

lead(0) (ISO)

lead(2+) (ISO)

methapyrilene (EXP)

methyl methanesulfonate (ISO)

miconazole (ISO)

N-ethyl-N-nitrosourea (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

okadaic acid (ISO)

p-menthan-3-ol (ISO)

paracetamol (ISO)

parathion (ISO)

PhIP (EXP)

phorbol 13-acetate 12-myristate (ISO)

propiconazole (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

thimerosal (ISO)

Tributyltin oxide (ISO)

valproic acid (ISO)

vincristine (ISO)

vitamin E (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

liver regeneration (IEP)

maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (IBA)

ribosomal large subunit biogenesis (ISO)

rRNA processing (ISO)

Cellular Component

A band (IDA)

cytosolic large ribosomal subunit (IBA,IDA,ISO)

cytosolic ribosome (ISO)

polysome (ISO)

postsynaptic density (ISO)

ribonucleoprotein complex (ISO)

ribosome (IDA)

synapse (ISO)

Molecular Function

5S rRNA binding (IDA)

DNA binding (ISO)

identical protein binding (ISO)

mRNA binding (ISO)

protein binding (ISO)

RNA binding (IBA)

structural constituent of ribosome (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structures of the human and Drosophila 80S ribosome.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	Coordinate regulation of ribosomal protein mRNA level in regenerating rat liver. Study with the corresponding mouse cloned cDNAs.	Faliks D and Meyuhas O, Nucleic Acids Res. 1982 Feb 11;10(3):789-801.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Immunological localization of ribosomes in striated rat muscle. Evidence for myofibrillar association and ontological changes in the subsarcolemmal:myofibrillar distribution.	Horne Z and Hesketh J, Biochem J. 1990 May 15;268(1):231-6.
5.	Selective high-efficiency cross-linking of mammalian ribosomal proteins with cleavable thiol-directed heterobifunctional reagents: identification and binding directions of major protein complexes.	Hultin T Biochim Biophys Acta. 1986 Aug 15;872(3):226-35.
6.	Studies on interaction of 5 S RNA with ribosomal proteins.	Kargel HJ, etal., FEBS Lett. 1987 Aug 10;220(1):126-8.
7.	The primary structure of rat ribosomal protein L7. The presence near the amino terminus of L7 of five tandem repeats of a sequence of 12 amino acids.	Lin A, etal., J Biol Chem 1987 Sep 15;262(26):12665-71.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Isolation of eukaryotic ribosomal proteins. Purification and characterization of 60 S ribosomal subunit proteins L3, L6, L7', L8, L10, L15, L17, L18, L19, L23', L25, L27', L28, L29, L31, L32, L34, L35, L36, L36', and L37'.	Tsurugi K, etal., J Biol Chem. 1977 Jun 10;252(11):3961-9.

Additional References at PubMed

PMID:2648130	PMID:7654221	PMID:8441630	PMID:12477932	PMID:12962325	PMID:16452087	PMID:16791210	PMID:18697920	PMID:18809582	PMID:19946888	PMID:21170055	PMID:21423176
PMID:21630459	PMID:21700703	PMID:22022532	PMID:22658674	PMID:22681889	PMID:23376485	PMID:29476059	PMID:30053369

Genomics

Comparative Map Data

Rpl7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	3,217,184 - 3,220,192 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	5	5,334,591 - 5,337,603 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	6,973,456 - 6,976,468 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	6,670,423 - 6,673,424 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	2,633,517 - 2,636,525 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	2,632,712 - 2,640,021 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	2,621,855 - 2,624,863 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	2,315,766 - 2,318,774 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	2,315,744 - 2,318,414 (+)	NCBI
Celera	5	2,818,341 - 2,821,349 (+)	NCBI		Celera
Cytogenetic Map	5	q11	NCBI

RPL7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	73,290,242 - 73,294,466 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	8	73,290,242 - 73,295,789 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	74,202,477 - 74,206,701 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	74,365,428 - 74,368,423 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	74,365,429 - 74,368,422	NCBI
Celera	8	70,200,410 - 70,203,406 (-)	NCBI		Celera
Cytogenetic Map	8	q21.11	NCBI
HuRef	8	69,693,718 - 69,696,713 (-)	NCBI		HuRef
CHM1_1	8	74,255,572 - 74,258,567 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	73,719,762 - 73,723,986 (-)	NCBI		T2T-CHM13v2.0

Rpl7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	16,171,519 - 16,174,657 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	16,171,519 - 16,174,886 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	16,101,295 - 16,104,433 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	16,101,295 - 16,104,662 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	16,091,376 - 16,094,514 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	16,086,512 - 16,089,621 (-)	NCBI		MGSCv36	mm8
Celera	1	16,037,288 - 16,040,427 (-)	NCBI		Celera
Cytogenetic Map	1	A3	NCBI

Rpl7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955444	6,910,818 - 6,914,047 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPL7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	8	71,476,492 - 71,480,285 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	71,476,492 - 71,480,279 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	8	69,829,356 - 69,833,184 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

RPL7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	21,881,048 - 21,884,401 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	21,881,044 - 21,884,731 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	22,145,346 - 22,148,699 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	21,990,809 - 21,994,219 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	21,990,492 - 21,994,871 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	22,048,894 - 22,052,259 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	22,085,699 - 22,089,052 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	22,366,605 - 22,369,956 (-)	NCBI		UU_Cfam_GSD_1.0

Rpl7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	57,390,000 - 57,393,185 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936648	2,055,396 - 2,057,395 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936648	2,055,396 - 2,058,664 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	62,601,569 - 62,605,892 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	62,602,430 - 62,605,892 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Pig Cytomap	4	q11-q14	NCBI

RPL7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	68,899,626 - 68,902,757 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	72,469,006 - 72,472,687 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624744	17,869,862 - 17,873,175 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpl7
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	74
Count of miRNA genes:	71
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000009431
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	2138965	32656739	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
631551	Vetf1	Vascular elastic tissue fragility QTL 1	5	0.0001	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	5	2282226	5904428	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC159423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC159431	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M17422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000009431 ⟹ ENSRNOP00000009431

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	2,632,712 - 2,640,021 (+)	Ensembl

RefSeq Acc Id:

NM_001100534 ⟹ NP_001094004

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	3,217,184 - 3,220,192 (+)	NCBI
Rnor_6.0	5	2,633,517 - 2,636,525 (+)	NCBI
Rnor_5.0	5	2,621,855 - 2,624,863 (+)	NCBI
RGSC_v3.4	5	2,315,766 - 2,318,774 (+)	RGD
Celera	5	2,818,341 - 2,821,349 (+)	RGD

Sequence:

show sequence

CATGGAGGCTGTACCAGAGAAGAAAAAGAAGGTTGCCGCTGCGCCAGGAACCCTTAAGAAGAAA
AAGGTTCCTGCGGTGCCAGAAACCCTTAAGAAAAAGCGAAGGAATTTCGCAGAGTTGAAGGTCA
AGCGCCTGAGGAAGAAGTTTGCCCTGAAGACACTGCGAAAGGCAAGGAGGAAGCTCATCTATGA
GAAGGCAAAGCACTATCACAAGGAGTACAGACAGATGTACCGGACTGAGATTCGCATGGCTAGG
ATGGCGAGGAAAGCTGGCAACTTCTATGTGCCCGCAGAACCAAAATTGGCCTTTGTCATCAGAA
TCCGAGGTATCAATGGAGTGAGCCCAAAGGTGCGCAAGGTGCTGCAGCTGCTCCGTCTCCGGCA
GATCTTCAATGGCACCTTTGTGAAGCTCAACAAGGCTTCAGTGAACATGCTGAGGATCGTGGAG
CCCTACATTGCATGGGGGTACCCCAACCTGAAGTCAGTAAACGAGCTCATCTACAAACGAGGCT
ATGGCAAAATCAATAAAAAGCGCATTGCCTTGACAGATAACTCCTTGGTTGCTCGATCTCTTGG
TAAATTTGGCATCATCTGCATGGAGGATCTAATTCATGAGATCTATACAGTTGGAAAACGCTTT
AAGGAAGCAAATAACTTCCTGTGGCCCTTCAAACTGTCTTCCCCACGAGGTGGAATGAAGAAAA
AGACAACTCACTTTGTAGAAGGTGGAGACGCTGGCAACAGGGAAGACCAGATAAACAGGCTTAT
TAGACGGATGAACTAAGGTATTGCCCGTGGTATTTTTATAATCTGGTCGGTTAATAAACAGTCA
CAGCTTGGCAAATTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094004	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42075	(Get FASTA)	NCBI Sequence Viewer
	AAI59424	(Get FASTA)	NCBI Sequence Viewer
	AAI59432	(Get FASTA)	NCBI Sequence Viewer
	EDM11514	(Get FASTA)	NCBI Sequence Viewer
	P05426	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001094004 ⟸ NM_001100534

- UniProtKB:

B0K031 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAVPEKKKKVAAAPGTLKKKKVPAVPETLKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYE
KAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQ
IFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLVARSLG
KFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLI
RRMN

hide sequence

RefSeq Acc Id:

ENSRNOP00000009431 ⟸ ENSRNOT00000009431

Protein Domains

Ribosomal_L30 Ribosomal_L30_N

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P05426-F1-model_v2	AlphaFold	P05426	1-260	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693526

Promoter ID:

EPDNEW_R4049

Type:

multiple initiation site

Name:

Rpl7_1

Description:

ribosomal protein L7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	2,633,496 - 2,633,556	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735169	AgrOrtholog
BioCyc Gene	G2FUF-42303	BioCyc
Ensembl Genes	ENSRNOG00000006992	Ensembl
Gene3D-CATH	3.30.1390.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9023627	IMAGE-MGC_LOAD
	IMAGE:9091211	IMAGE-MGC_LOAD
InterPro	L30_ferredoxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L30_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L30_ferredoxin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L30_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L7/L30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L7_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L7_euk_arc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:297755	UniProtKB/TrEMBL
MGC_CLONE	MGC:188724	IMAGE-MGC_LOAD
	MGC:188753	IMAGE-MGC_LOAD
NCBI Gene	297755	ENTREZGENE
PANTHER	PTHR11524	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ribosomal_L30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L30_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rpl7	PhenoGen
PROSITE	RIBOSOMAL_L30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF55129	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGRFAMs	uL30_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	B0K023_RAT	UniProtKB/TrEMBL
	B0K031	ENTREZGENE, UniProtKB/TrEMBL
	P05426	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Rpl7	ribosomal protein L7			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations