Tlr2 (toll-like receptor 2) - Rat Genome Database

Name: Tlr2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tlr2 (toll-like receptor 2) Rattus norvegicus

Analyze

Symbol:

Tlr2

Name:

toll-like receptor 2

RGD ID:

735138

Description:

Enables lipopeptide binding activity. Involved in several processes, including central nervous system myelin formation; positive regulation of interleukin-10 production; and response to molecule of bacterial origin. Located in cell body; cell projection; and cell surface. Used to study carotid stenosis; ileitis; keratitis; lung disease (multiple); and renal fibrosis. Biomarker of acute necrotizing pancreatitis; kidney failure; lung disease; pancreatitis; and perinatal necrotizing enterocolitis. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); dermatitis (multiple); gastrointestinal system cancer (multiple); lung disease (multiple); and rhinitis (multiple). Orthologous to human TLR2 (toll like receptor 2); PARTICIPATES IN Toll-like receptor signaling pathway; Chagas disease pathway; Entamoebiasis pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

toll-like receptor 2 variant 1; toll-like receptor 2 variant 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TLR2 (toll like receptor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tlr2 (toll-like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tlr2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TLR2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TLR2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tlr2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TLR2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TLR2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tlr2 (toll like receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TLR2 (toll like receptor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tlr2 (toll-like receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tlr2 (toll-like receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Toll-9	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	tlr2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ube2k	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Iddm54

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	169,200,620 - 169,206,819 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	169,197,419 - 169,206,630 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	176,379,970 - 176,385,353 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	174,399,903 - 174,405,286 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	169,001,363 - 169,006,752 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	182,840,171 - 182,846,061 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	182,840,727 - 182,846,061 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	202,252,701 - 202,258,962 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	175,607,990 - 175,613,992 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	175,558,096 - 175,564,098 (-)	NCBI
Celera	2	163,202,040 - 163,207,399 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal obesity-metabolic syndrome 1 (ISO)

acne (ISO)

acute kidney failure (ISO)

acute necrotizing pancreatitis (IEP)

Acute Tubulointerstitial Nephritis (ISO)

allergic conjunctivitis (ISO)

allergic rhinitis (ISO)

alveolar echinococcosis (ISO)

anogenital venereal wart (ISO)

anterior uveitis (ISO)

Anti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis (ISO)

aspergillosis (ISO)

asthma (ISO)

atherosclerosis (ISO)

atopic dermatitis (ISO)

atrial fibrillation (ISO)

Bacterial Eye Infections (ISO)

Bacterial Keratitis (ISO)

bacterial pneumonia (IDA,ISO)

Behcet's disease (ISO)

Brain Abscess (ISO)

Brain Hypoxia-Ischemia (ISO)

Brain Injuries (IEP,ISO)

breast cancer (ISO)

cardiomyopathy (ISO)

Cardiotoxicity (ISO)

carotid artery thrombosis (ISO)

carotid stenosis (IDA)

cholangitis (ISO)

cholestasis (ISO)

cholesteatoma (ISO)

cholesteatoma of middle ear (ISO)

Choroidal Neovascularization (ISO)

Chronic Hepatitis B (ISO)

Chronic Pain (ISO)

Chronic Periodontitis (ISO)

clonorchiasis (ISO)

colorectal cancer (ISO)

Colorectal Neoplasms (ISO)

congestive heart failure (ISO)

Cough (ISO)

cutaneous leishmaniasis (ISO)

cystic echinococcosis (ISO)

dermatomyositis (ISO)

Diabetic Nephropathies (ISO)

diffuse scleroderma (ISO)

dry eye syndrome (ISO)

Dyslipidemias (IGI)

end stage renal disease (ISO)

endophthalmitis (ISO)

Endotoxemia (IDA)

Eosinophilia (ISO)

Escherichia Coli Meningitis (ISO)

essential hypertension (ISO)

eumycotic mycetoma (ISO)

Experimental Arthritis (IEP,ISO)

Experimental Autoimmune Encephalomyelitis (IEP)

Experimental Autoimmune Neuritis (IEP)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Liver Cirrhosis (IDA,ISO)

eye disease (ISO)

Fever (ISO)

Fungal Eye Infections (IEP)

gastroesophageal reflux disease (ISO)

genetic disease (ISO)

glomerulonephritis (ISO)

Gram-Positive Bacterial Infections (ISO)

Hearing Loss (ISO)

hepatitis B (ISO)

hepatocellular carcinoma (ISO)

Herpes Simplex Encephalitis (IEP,ISO)

herpes simplex virus keratitis (ISO)

Human Influenza (ISO)

Hyperalgesia (IDA,ISO)

ileitis (IMP)

Inflammation (IDA,ISO)

invasive aspergillosis (ISO)

keratitis (IMP,ISO)

keratoconjunctivitis (ISO)

kidney failure (IEP)

Kidney Reperfusion Injury (IDA,ISO)

Kuhnt-Junius degeneration (ISO)

leprosy (ISO)

leptospirosis (ISO)

liver cirrhosis (ISO)

Liver Reperfusion Injury (IEP,ISO)

lung disease (IDA,IEP,ISO)

mastoiditis (ISO)

membranoproliferative glomerulonephritis (ISO)

meningococcal meningitis (ISO)

mite infestation (ISO)

molluscum contagiosum (ISO)

myelodysplastic syndrome (ISO)

Myocardial Reperfusion Injury (IEP)

Nasal Polyps (ISO)

non-alcoholic steatohepatitis (ISO)

obesity (ISO)

obstructive jaundice (ISO)

Oral Lichen Planus (ISO)

otitis media (ISO)

Otitis Media with Effusion (ISO)

Pain (IDA)

pancreatitis (IEP)

perinatal necrotizing enterocolitis (IEP)

Plaque, Atherosclerotic (ISO)

Pneumococcal Meningitis (ISO)

Pneumococcal Pneumonia (ISO)

pneumocystosis (ISO)

pneumonia (ISO)

prostate cancer (ISO)

Pseudomonas Aeruginosa Keratitis (ISO)

psoriasis (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (ISO)

pulmonary sarcoidosis (ISO)

pulmonary tuberculosis (ISO)

renal fibrosis (IMP)

Reperfusion Injury (IEP,ISO)

respiratory syncytial virus infectious disease (ISO)

rheumatoid arthritis (ISO)

rhinitis (ISO)

Rhinosinusitis (ISO)

sciatic neuropathy (ISO)

seborrheic dermatitis (ISO)

Sepsis (IEP)

severe acute respiratory syndrome (ISO)

sinusitis (ISO)

skin papilloma (ISO)

Staphylococcal Infections (ISO)

Streptococcal Infections (ISO)

suppurative otitis media (ISO)

Transplant Rejection (IEP,ISO)

tuberculosis (ISO)

type 1 diabetes mellitus (ISO)

typhoid fever (ISO)

urinary bladder cancer (ISO)

urinary tract infection (ISO)

visceral leishmaniasis (ISO)

vitiligo (ISO)

Wallerian Degeneration (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (ISO)

(-)-citrinin (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4,6-trinitrobenzene (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2,2-trichloroethanol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-mercaptopropanoic acid (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (ISO)

acetamide (EXP)

acrylamide (ISO)

adapalene (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

Aflatoxin G1 (ISO)

aldehydo-D-glucose (ISO)

alfacalcidol (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinol (ISO)

alpha-D-galactose (EXP)

ammonium hexachloroplatinate (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

astaxanthin (ISO)

astemizole (EXP)

atorvastatin calcium (ISO)

azathioprine (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-chloroethyl) sulfide (ISO)

bisdemethoxycurcumin (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

bortezomib (ISO)

butanal (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbon atom (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

cerium trichloride (ISO)

CGP 52608 (ISO)

chitosan (ISO)

chlorpyrifos (EXP)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clothianidin (ISO)

cobalt atom (ISO)

copper atom (ISO)

copper(0) (ISO)

cortisol (ISO)

crocidolite asbestos (ISO)

curcumin (EXP,ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

cyhalothrin (EXP)

cyproconazole (ISO)

D-glucose (ISO)

deoxynivalenol (ISO)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

diclofenac (EXP,ISO)

dioxygen (EXP,ISO)

disodium selenite (ISO)

dopamine (EXP)

doxorubicin (EXP,ISO)

elemental carbon (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

fenoldopam (EXP)

ferric oxide (ISO)

ferulic acid (ISO)

fipronil (EXP)

folic acid (ISO)

fonofos (ISO)

furan (EXP)

galactose (EXP)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

glutathione (ISO)

gold atom (ISO)

gold(0) (ISO)

graphene oxide (ISO)

hexamethylene diisocyanate (ISO)

histamine (ISO)

hyaluronic acid (ISO)

hydroxycitronellal (ISO)

icosanoid (ISO)

indometacin (EXP,ISO)

indoprofen (ISO)

irinotecan (ISO)

iron(2+) sulfate (anhydrous) (ISO)

isoeugenol (ISO)

ivermectin (ISO)

kaempferol 3-O-beta-D-glucosyl-(1->2)-beta-D-glucoside (ISO)

L-ascorbic acid (ISO)

lead(0) (ISO)

levamisole (ISO)

lipophosphoglycan (ISO)

lipopolysaccharide (EXP,ISO)

lipoteichoic acid (ISO)

lycopene (ISO)

metformin (ISO)

methamphetamine (EXP,ISO)

methotrexate (EXP,ISO)

methylseleninic acid (ISO)

muramyl dipeptide (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nitrites (ISO)

nitroprusside (ISO)

o-anisidine (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (ISO)

parathion (ISO)

pentachlorophenol (ISO)

pentanal (ISO)

pentane-2,3-dione (EXP)

peptidoglycan (ISO)

phenobarbital (ISO)

phenytoin (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

poly(I:C) (ISO)

prednisolone (ISO)

progesterone (ISO)

propanal (ISO)

propiconazole (ISO)

prostaglandin E2 (ISO)

quercetin (ISO)

raloxifene (ISO)

reactive oxygen species (ISO)

resveratrol (EXP,ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

SB 203580 (ISO)

SCH 23390 (EXP)

silicon dioxide (EXP,ISO)

simvastatin (ISO)

sodium aurothiomalate (ISO)

sodium dichromate (EXP)

sodium dodecyl sulfate (ISO)

sulfasalazine (ISO)

sulfur dioxide (ISO)

sulindac (EXP)

tacrolimus hydrate (ISO)

terbufos (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thymoquinone (EXP)

tibolone (ISO)

titanium atom (EXP)

titanium dioxide (EXP,ISO)

topotecan (EXP)

trans-isoeugenol (ISO)

tributyrin (EXP)

trichloroethene (EXP)

trimellitic anhydride (ISO)

Tungsten carbide (ISO)

vinclozolin (EXP)

vitamin D (ISO)

vorinostat (ISO)

zinc oxide (ISO)

zinc protoporphyrin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell surface pattern recognition receptor signaling pathway (ISO)

cellular response to bacterial lipopeptide (ISO)

cellular response to diacyl bacterial lipopeptide (ISO)

cellular response to lipoteichoic acid (ISO)

cellular response to peptidoglycan (ISO)

cellular response to triacyl bacterial lipopeptide (ISO)

cellular response to type II interferon (ISO)

central nervous system myelin formation (IDA)

defense response (ISO)

defense response to Gram-positive bacterium (ISO)

defense response to virus (IEA)

detection of diacyl bacterial lipopeptide (ISO)

detection of triacyl bacterial lipopeptide (ISO)

ERK1 and ERK2 cascade (ISO)

immune response (NAS)

inflammatory response (IBA)

learning (ISO)

leukocyte migration (ISO)

leukotriene metabolic process (IDA)

microglia development (ISO)

microglial cell activation (IDA)

MyD88-dependent toll-like receptor signaling pathway (ISO)

negative regulation of actin filament polymerization (ISO)

negative regulation of cell population proliferation (IDA)

negative regulation of interleukin-12 production (ISO)

negative regulation of interleukin-17 production (ISO)

negative regulation of phagocytosis (ISO)

negative regulation of synapse assembly (ISO)

neutrophil migration (ISO)

nitric oxide biosynthetic process (ISO)

nitric oxide metabolic process (IDA)

non-canonical NF-kappaB signal transduction (ISO)

positive regulation of cellular response to macrophage colony-stimulating factor stimulus (ISO)

positive regulation of chemokine production (ISO)

positive regulation of cytokine production (ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

positive regulation of gene expression (ISO)

positive regulation of inflammatory response (ISO)

positive regulation of interferon-beta production (ISO)

positive regulation of interleukin-1 beta production (ISO)

positive regulation of interleukin-10 production (IDA)

positive regulation of interleukin-12 production (ISO)

positive regulation of interleukin-18 production (ISO)

positive regulation of interleukin-6 production (ISO)

positive regulation of interleukin-8 production (ISO)

positive regulation of leukocyte migration (ISO)

positive regulation of macrophage cytokine production (ISO)

positive regulation of matrix metallopeptidase secretion (ISO)

positive regulation of neutrophil migration (ISO)

positive regulation of nitric oxide biosynthetic process (ISO)

positive regulation of nitric-oxide synthase biosynthetic process (ISO)

positive regulation of non-canonical NF-kappaB signal transduction (ISO)

positive regulation of oligodendrocyte differentiation (IDA)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of tumor necrosis factor production (ISO)

positive regulation of Wnt signaling pathway (ISO)

positive regulation of xenophagy (ISO)

regulation of dendritic cell cytokine production (ISO)

response to bacterial lipoprotein (IDA)

response to bacterium (ISO)

response to fatty acid (IDA)

response to hypoxia (IEP)

response to insulin (IEP)

response to lipopolysaccharide (IEP)

response to molecule of fungal origin (ISO)

response to peptidoglycan (ISO)

response to progesterone (IEP)

response to toxic substance (IEP)

toll-like receptor 2 signaling pathway (ISO)

toll-like receptor signaling pathway (IBA,IDA,IMP,ISO)

toll-like receptor TLR6:TLR2 signaling pathway (ISO)

xenophagy (ISO)

Cellular Component

cell body (IDA)

cell projection (IDA)

cell surface (IDA,ISO)

cytoplasm (ISO)

external side of plasma membrane (ISO)

Golgi apparatus (ISO)

membrane raft (ISO)

plasma membrane (ISO)

receptor complex (ISO)

Toll-like receptor 1-Toll-like receptor 2 protein complex (ISO)

Toll-like receptor 2-Toll-like receptor 6 protein complex (ISO)

Molecular Function

amyloid-beta binding (ISO)

diacyl lipopeptide binding (ISO)

identical protein binding (ISO)

lipopeptide binding (IMP)

lipopolysaccharide binding (ISO)

lipoteichoic acid binding (ISO)

pattern recognition receptor activity (ISO)

peptidoglycan binding (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (ISO)

signaling receptor activity (IBA)

Toll-like receptor binding (ISO)

transmembrane signaling receptor activity (IEA)

triacyl lipopeptide binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

Entamoebiasis pathway (IEA)

Leishmaniasis pathway (IEA)

malaria pathway (IEA)

measles pathway (IEA)

phagocytosis pathway (IEA)

rheumatoid arthritis pathway (IEA)

Toll-like receptor signaling pathway (IDA,IEA,IMP,ISO)

toxoplasmosis pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	[Changes of Toll-like Receptor mRNA and Related Cytokines in Patients with Hepatic Alveolar Echinococcosis].	Abudusalamu A, etal., Zhongguo Ji Sheng Chong Xue Yu Ji Sheng Chong Bing Za Zhi. 2016 Dec;34(6):542-6.
2.	Serum Toll-Like Receptor-2, Toll-Like Receptor-4 Levels in Patients with HBeAg-Negative Chronic Viral Hepatitis B.	Akbal E, etal., Viral Immunol. 2017 May;30(4):278-282. doi: 10.1089/vim.2016.0131. Epub 2017 Apr 17.
3.	Complement activation and toll-like receptor-2 signaling contribute to cytokine production after renal ischemia/reperfusion.	Amura CR, etal., Mol Immunol. 2012 Oct;52(3-4):249-57. doi: 10.1016/j.molimm.2012.05.020. Epub 2012 Jun 27.
4.	Pivotal advance: HMGB1 expression in active lesions of human and experimental multiple sclerosis.	Andersson A, etal., J Leukoc Biol. 2008 Nov;84(5):1248-55. Epub 2008 Jul 21.
5.	Immunolocalization of toll-like receptor 2 in viral warts and molluscum contagiosum.	Bakry OA, etal., Anal Quant Cytol Histol. 2013 Dec;35(6):316-23.
6.	Involvement of toll-like receptor 2 in experimental invasive pulmonary aspergillosis.	Balloy V, etal., Infect Immun. 2005 Sep;73(9):5420-5.
7.	TLR4 links podocytes with the innate immune system to mediate glomerular injury.	Banas MC, etal., J Am Soc Nephrol. 2008 Apr;19(4):704-13. doi: 10.1681/ASN.2007040395. Epub 2008 Feb 6.
8.	Toll-like-receptor gene polymorphisms in a Tunisian population with Behcet's disease.	Ben Dhifallah I, etal., Clin Exp Rheumatol. 2009 Mar-Apr;27(2 Suppl 53):S58-62.
9.	Influence of perineurial cells and Toll-like receptors 2 and 9 on Herpes simplex type 1 entry to the central nervous system in rat encephalitis.	Bereczky-Veress B, etal., PLoS One. 2010 Aug 27;5(8):e12350.
10.	A TLR2 polymorphism is associated with type 1 diabetes and allergic asthma.	Bjornvold M, etal., Genes Immun. 2009 Mar;10(2):181-7. Epub 2009 Jan 15.
11.	Toll-like receptor 2 (TLR2) polymorphisms are associated with reversal reaction in leprosy.	Bochud PY, etal., J Infect Dis. 2008 Jan 15;197(2):253-61. doi: 10.1086/524688.
12.	Toll-like receptor signaling is critical for Wallerian degeneration and functional recovery after peripheral nerve injury.	Boivin A, etal., J Neurosci. 2007 Nov 14;27(46):12565-76.
13.	Differential regulation of Toll-like receptor mRNAs in experimental murine central nervous system infections.	Bottcher T, etal., Neurosci Lett. 2003 Jun 19;344(1):17-20.
14.	MyD88 signaling pathway is involved in renal fibrosis by favoring a TH2 immune response and activating alternative M2 macrophages.	Braga TT, etal., Mol Med. 2012 Oct 24;18:1231-9. doi: 10.2119/molmed.2012.00131.
15.	A rare polymorphism in the gene for Toll-like receptor 2 is associated with systemic sclerosis phenotype and increases the production of inflammatory mediators.	Broen JC, etal., Arthritis Rheum. 2012 Jan;64(1):264-71. doi: 10.1002/art.33325.
16.	TLR2 stimulation of intrinsic renal cells in the induction of immune-mediated glomerulonephritis.	Brown HJ, etal., J Immunol. 2006 Aug 1;177(3):1925-31.
17.	R753Q single-nucleotide polymorphism impairs toll-like receptor 2 recognition of hepatitis C virus core and nonstructural 3 proteins.	Brown RA, etal., Transplantation. 2010 Apr 15;89(7):811-5. doi: 10.1097/TP.0b013e3181cbac18.
18.	Toll-like receptors 2 and 3 agonists differentially affect oligodendrocyte survival, differentiation, and myelin membrane formation.	Bsibsi M, etal., J Neurosci Res. 2012 Feb;90(2):388-98. doi: 10.1002/jnr.22767. Epub 2011 Oct 4.
19.	Toll like receptor-2 modulates both innate and adaptive immune responses during chronic fungal asthma in mice.	Buckland KF, etal., Inflamm Res. 2008 Aug;57(8):379-87.
20.	Inhibition of toll-like receptor 2 expression improves insulin sensitivity and signaling in muscle and white adipose tissue of mice fed a high-fat diet.	Caricilli AM, etal., J Endocrinol. 2008 Dec;199(3):399-406. Epub 2008 Sep 11.
21.	TLR2, TLR4 and the MYD88 signaling pathway are crucial for neutrophil migration in acute kidney injury induced by sepsis.	Castoldi A, etal., PLoS One. 2012;7(5):e37584. doi: 10.1371/journal.pone.0037584. Epub 2012 May 24.
22.	Changes in Toll-like receptor (TLR)-2 and TLR4 expression and function but not polymorphisms are associated with acute anterior uveitis.	Chang JH, etal., Invest Ophthalmol Vis Sci. 2007 Apr;48(4):1711-7.
23.	TLR4- and TLR2-mediated B cell responses control the clearance of the bacterial pathogen, Leptospira interrogans.	Chassin C, etal., J Immunol. 2009 Aug 15;183(4):2669-77. doi: 10.4049/jimmunol.0900506. Epub 2009 Jul 27.
24.	Progesterone administration modulates TLRs/NF-kappaB signaling pathway in rat brain after cortical contusion.	Chen G, etal., Ann Clin Lab Sci. 2008 Winter;38(1):65-74.
25.	Engagement of Toll-like receptor 2 on CD4(+) T cells facilitates local immune responses in patients with tuberculous pleurisy.	Chen X, etal., J Infect Dis. 2009 Aug 1;200(3):399-408.
26.	Toll-like receptor 2 gene polymorphisms, pulmonary tuberculosis, and natural killer cell counts.	Chen YC, etal., BMC Med Genet. 2010 Jan 30;11:17.
27.	Staphylococcus aureus accelerates an experimental allergic conjunctivitis by Toll-like receptor 2-dependent manner.	Chung SH, etal., Clin Immunol. 2009 Apr;131(1):170-7.
28.	Nasal polyps in patients with and without cystic fibrosis: a differentiation by innate markers and inflammatory mediators.	Claeys S, etal., Clin Exp Allergy. 2005 Apr;35(4):467-72.
29.	Toll-like receptor 2 expression on human conjunctival epithelial cells: a pathway for Staphylococcus aureus involvement in chronic ocular proinflammatory responses.	Cook EB, etal., Ann Allergy Asthma Immunol. 2005 Apr;94(4):486-97.
30.	Pivotal role of Toll-like receptors 2 and 4, its adaptor molecule MyD88, and inflammasome complex in experimental tubule-interstitial nephritis.	Correa-Costa M, etal., PLoS One. 2011;6(12):e29004. doi: 10.1371/journal.pone.0029004. Epub 2011 Dec 14.
31.	HCV-related liver and lymphoproliferative diseases: association with polymorphisms of IL28B and TLR2.	De Re V, etal., Oncotarget. 2016 Jun 21;7(25):37487-37497. doi: 10.18632/oncotarget.9303.
32.	Role of Toll-like receptors 2 and 4 in pulmonary inflammation and injury induced by pneumolysin in mice.	Dessing MC, etal., PLoS One. 2009 Nov 24;4(11):e7993.
33.	Knockout of toll-like receptor-2 attenuates both the proinflammatory state of diabetes and incipient diabetic nephropathy.	Devaraj S, etal., Arterioscler Thromb Vasc Biol. 2011 Aug;31(8):1796-804. doi: 10.1161/ATVBAHA.111.228924. Epub 2011 May 26.
34.	Increased toll-like receptor (TLR) 2 and TLR4 expression in monocytes from patients with type 1 diabetes: further evidence of a proinflammatory state.	Devaraj S, etal., J Clin Endocrinol Metab. 2008 Feb;93(2):578-83. Epub 2007 Nov 20.
35.	Systemic up-regulation of TLR4 causes lipopolysaccharide-induced augmentation of nasal cytokine release in allergic rhinitis.	Ekman AK, etal., Int Arch Allergy Immunol. 2012;159(1):6-14. doi: 10.1159/000335196. Epub 2012 Apr 27.
36.	Association of TLR2 gene polymorphisms with ocular Behcet's disease in a Chinese Han population.	Fang J, etal., Invest Ophthalmol Vis Sci. 2013 Dec 30;54(13):8384-92. doi: 10.1167/iovs.13-12878.
37.	Inhibition of TLR2 promotes graft function in a murine model of renal transplant ischemia-reperfusion injury.	Farrar CA, etal., FASEB J. 2012 Feb;26(2):799-807. doi: 10.1096/fj.11-195396. Epub 2011 Oct 31.
38.	Expression of toll-like receptor 2 on peripheral blood monocytes of patients with inflammatory and noninflammatory acne vulgaris.	Fathy A, etal., Egypt J Immunol. 2009;16(1):127-34.
39.	Stem cell therapy for arterial restenosis: potential parameters contributing to the success of bone marrow-derived mesenchymal stromal cells.	Forte A, etal., Cardiovasc Drugs Ther. 2012 Feb;26(1):9-21. doi: 10.1007/s10557-011-6359-8.
40.	Up-regulation of Toll-like receptors 2, 3 and 4 in allergic rhinitis.	Fransson M, etal., Respir Res. 2005 Sep 7;6:100.
41.	Differential effect of insulin treatment on decreased levels of beta-defensins and Toll-like receptors in diabetic rats.	Froy O, etal., Mol Immunol. 2007 Feb;44(5):796-802. Epub 2006 Jun 5.
42.	A Toll-like receptor 2/6 agonist reduces allergic airway inflammation in chronic respiratory sensitisation to Timothy grass pollen antigens.	Fuchs B, etal., Int Arch Allergy Immunol. 2010;152(2):131-9. Epub 2009 Dec 16.
43.	Choroidal neovascularization enhanced by Chlamydia pneumoniae via Toll-like receptor 2 in the retinal pigment epithelium.	Fujimoto T, etal., Invest Ophthalmol Vis Sci. 2010 Sep;51(9):4694-702. doi: 10.1167/iovs.09-4464. Epub 2010 Apr 14.
44.	Disordered Toll-like receptor 2 responses in the pathogenesis of pulmonary sarcoidosis.	Gabrilovich MI, etal., Clin Exp Immunol. 2013 Sep;173(3):512-22. doi: 10.1111/cei.12138.
45.	GSK-3beta inhibitor modulates TLR2/NF-kappaB signaling following myocardial ischemia-reperfusion.	Gao HK, etal., Inflamm Res. 2009 Mar 10.
46.	Increased gene expression of Toll-like receptor 4 on peripheral blood mononuclear cells in patients with psoriasis.	Garcia-Rodriguez S, etal., J Eur Acad Dermatol Venereol. 2013 Feb;27(2):242-50.
47.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
48.	Toll-like receptor 2 regulates CXC chemokine production and neutrophil recruitment to the cornea in Onchocerca volvulus/Wolbachia-induced keratitis.	Gillette-Ferguson I, etal., Infect Immun. 2007 Dec;75(12):5908-15. Epub 2007 Sep 17.
49.	Toll-like receptor 2 siRNA suppresses corneal inflammation and attenuates Aspergillus fumigatus keratitis in rats.	Guo H, etal., Immunol Cell Biol. 2012 Mar;90(3):352-7. doi: 10.1038/icb.2011.49. Epub 2011 Jun 7.
50.	Combinations of TLR and NOD2 ligands stimulate rat microglial P2X4R expression.	Guo LH, etal., Biochem Biophys Res Commun. 2006 Oct 27;349(3):1156-62. Epub 2006 Sep 1.
51.	Importance of TLR2 in early innate immune response to acute pulmonary infection with Porphyromonas gingivalis in mice.	Hajishengallis G, etal., J Immunol. 2008 Sep 15;181(6):4141-9.
52.	Role for Toll-like receptor 2 in the immune response to Streptococcus pneumoniae infection in mouse otitis media.	Han F, etal., Infect Immun. 2009 Jul;77(7):3100-8. doi: 10.1128/IAI.00204-09. Epub 2009 May 4.
53.	Selective impairment of Toll-like receptor 2-mediated proinflammatory cytokine production by monocytes from patients with atopic dermatitis.	Hasannejad H, etal., J Allergy Clin Immunol. 2007 Jul;120(1):69-75. Epub 2007 May 25.
54.	Toll-like receptor 2-mediated NF-kappaB inflammatory responses in dry eye associated with cGVHD.	He C, etal., Mol Vis. 2011;17:2605-11. Epub 2011 Oct 5.
55.	Tlr2 is critical for diet-induced metabolic syndrome in a murine model.	Himes RW and Smith CW, FASEB J. 2010 Mar;24(3):731-9. doi: 10.1096/fj.09-141929. Epub 2009 Oct 19.
56.	Expression of toll-like receptors in chronic otitis media and cholesteatoma.	Hirai H, etal., Int J Pediatr Otorhinolaryngol. 2013 May;77(5):674-6. doi: 10.1016/j.ijporl.2013.01.010. Epub 2013 Feb 4.
57.	Impact of Toll-like receptor 2 expression in renal allograft rejection.	Hoffmann U, etal., Nephrol Dial Transplant. 2011 Mar;26(3):1080-7. doi: 10.1093/ndt/gfq420. Epub 2010 Jul 13.
58.	Aberrant expression and dysfunction of TLR2 and its soluble form in chronic HBV infection and its regulation by antiviral therapy.	Huang Z, etal., Antiviral Res. 2015 Jun;118:10-9. doi: 10.1016/j.antiviral.2015.03.004. Epub 2015 Mar 12.
59.	Pyrexia, anorexia, adipsia, and depressed motor activity in rats during systemic inflammation induced by the Toll-like receptors-2 and -6 agonists MALP-2 and FSL-1.	Hubschle T, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Jan;290(1):R180-7. Epub 2005 Sep 8.
60.	Toll-like receptor 2 is highly expressed in lesions of acne inversa and colocalizes with C-type lectin receptor.	Hunger RE, etal., Br J Dermatol. 2008 Apr;158(4):691-7. doi: 10.1111/j.1365-2133.2007.08425.x. Epub 2008 Jan 30.
61.	Toll-like receptor 2 and Toll-like receptor 4 polymorphisms and susceptibility to asthma and allergic rhinitis: a case-control analysis.	Hussein YM, etal., Cell Immunol. 2012;274(1-2):34-8. doi: 10.1016/j.cellimm.2012.02.006. Epub 2012 Feb 17.
62.	The role of infection in the development of non-valvular atrial fibrillation: up-regulation of Toll-like receptor 2 expression levels on monocytes.	Ichiki H, etal., J Cardiol. 2009 Feb;53(1):127-35. doi: 10.1016/j.jjcc.2008.09.008. Epub 2008 Nov 25.
63.	Double blind clinical trial in a series of 115 patients with seborrheic dermatitis: prevention of relapses using a topical modulator of Toll like receptor 2.	Ionescu MA, etal., G Ital Dermatol Venereol. 2011 Jun;146(3):185-9.
64.	Expression of Toll-Like Receptors 2, 4 and Nuclear Factor Kappa B in Mucosal Lesions of Human Otitis: Pattern and Relationship in a Clinical Immunohistochemical Study.	Jesic S, etal., Ann Otol Rhinol Laryngol. 2014 Apr 1.
65.	Toll like receptor 2 knock-out attenuates carbon tetrachloride (CCl4)-induced liver fibrosis by downregulating MAPK and NF-κB signaling pathways.	Ji L, etal., FEBS Lett. 2014 Jun 5;588(12):2095-100. doi: 10.1016/j.febslet.2014.04.042. Epub 2014 May 8.
66.	Activation of Toll-like receptors 2 and 4 in Aspergillus fumigatus keratitis.	Jie Zhao, etal., Innate Immun. 2009 Jun;15(3):155-68.
67.	Expression of toll-like receptors in the Fusarium solani infected cornea.	Jin X, etal., Curr Eye Res. 2008 Apr;33(4):319-24. doi: 10.1080/02713680802008238.
68.	The delayed response of Toll-like receptors may relate to Pseudomonas aeruginosa keratitis exacerbating rapidly at the early stages of infection.	Jin X, etal., Eur J Clin Microbiol Infect Dis. 2010 Feb;29(2):231-8. doi: 10.1007/s10096-009-0844-z. Epub 2009 Dec 13.
69.	[Effects of intestinal trefoil factor on Toll-like receptors 2 and 4 expression in intestinal tissue in young rats with endotoxemia].	Jing K and Sun M, Zhongguo Dang Dai Er Ke Za Zhi. 2011 Dec;13(12):985-8.
70.	Gut microbiota regulate hepatic von Willebrand factor synthesis and arterial thrombus formation via Toll-like receptor-2.	Jäckel S, etal., Blood. 2017 Jul 27;130(4):542-553. doi: 10.1182/blood-2016-11-754416. Epub 2017 Jun 1.
71.	Toll-like receptor 2 expression level on monocytes in patients with viral infections: monitoring infection severity.	Kajiya T, etal., J Infect. 2008 Sep;57(3):249-59. Epub 2008 Jul 26.
72.	Identification of polymorphisms in the Toll-like receptor gene and the association with allergic rhinitis.	Kang I, etal., Eur Arch Otorhinolaryngol. 2010 Mar;267(3):385-9. Epub 2009 Sep 18.
73.	TLR2 and TLR4 gene polymorphisms in Turkish vitiligo patients.	Karaca N, etal., J Eur Acad Dermatol Venereol. 2013 Jan;27(1):e85-90. doi: 10.1111/j.1468-3083.2012.04514.x. Epub 2012 Mar 16.
74.	Beneficial effects of TLR-2/6 ligation in pulmonary bacterial infection and immunization with Pseudomonas aeruginosa.	Kerber-Momot T, etal., Inflammation. 2010 Feb;33(1):58-64.
75.	Toll-like receptor 2 and 4 genes influence susceptibility to adverse effects of traffic-related air pollution on childhood asthma.	Kerkhof M, etal., Thorax. 2010 Aug;65(8):690-7.
76.	Delayed administration of pituitary adenylate cyclase-activating polypeptide 38 ameliorates renal ischemia/reperfusion injury in mice by modulating Toll-like receptors.	Khan AM, etal., Peptides. 2012 Dec;38(2):395-403. doi: 10.1016/j.peptides.2012.09.023. Epub 2012 Sep 28.
77.	Toll-like receptor 2 modulates the proinflammatory milieu in Staphylococcus aureus-induced brain abscess.	Kielian T, etal., Infect Immun. 2005 Nov;73(11):7428-35.
78.	Ischemia-reperfusion injury activates innate immunity in rat kidneys.	Kim BS, etal., Transplantation. 2005 May 27;79(10):1370-7.
79.	A critical role of toll-like receptor 2 in nerve injury-induced spinal cord glial cell activation and pain hypersensitivity.	Kim D, etal., J Biol Chem. 2007 May 18;282(20):14975-83. Epub 2007 Mar 13.
80.	Expression of TLR2, TLR4, and TLR9 in dermatomyositis and polymyositis.	Kim GT, etal., Clin Rheumatol. 2010 Mar;29(3):273-9. doi: 10.1007/s10067-009-1316-7. Epub 2009 Dec 2.
81.	Toll-like receptor 2 senses beta-cell death and contributes to the initiation of autoimmune diabetes.	Kim HS, etal., Immunity. 2007 Aug;27(2):321-33. Epub 2007 Aug 16.
82.	Macrophage-activating lipopeptide-2 (MALP-2) induces a localized inflammatory response in rats resulting in activation of brain sites implicated in fever.	Knorr C, etal., Brain Res. 2008 Apr 18;1205:36-46. Epub 2008 Feb 21.
83.	Toll-like receptor expression in monocytes in patients with chronic kidney disease and haemodialysis: relation with inflammation.	Koc M, etal., Nephrol Dial Transplant. 2011 Mar;26(3):955-63. doi: 10.1093/ndt/gfq500. Epub 2010 Aug 20.
84.	Elucidating the molecular physiopathology of acute respiratory distress syndrome in severe acute respiratory syndrome patients.	Kong SL, etal., Virus Res. 2009 Nov;145(2):260-9. Epub 2009 Jul 25.
85.	Toll-like receptor 2 ligand-induced protection against bacterial endophthalmitis.	Kumar A, etal., J Infect Dis. 2010 Jan 15;201(2):255-63. doi: 10.1086/649589.
86.	Pathogen recognition by the innate immune system.	Kumar H, etal., Int Rev Immunol. 2011 Feb;30(1):16-34.
87.	Herpes simplex virus 1 interaction with Toll-like receptor 2 contributes to lethal encephalitis.	Kurt-Jones EA, etal., Proc Natl Acad Sci U S A. 2004 Feb 3;101(5):1315-20. Epub 2004 Jan 22.
88.	TLR 2 and 4 responsiveness from isolated peripheral blood mononuclear cells from rats and humans as potential chronic pain biomarkers.	Kwok YH, etal., PLoS One. 2013 Oct 30;8(10):e77799. doi: 10.1371/journal.pone.0077799. eCollection 2013.
89.	The role of Toll-like receptor 2 in inflammation and fibrosis during progressive renal injury.	Leemans JC, etal., PLoS One. 2009 May 27;4(5):e5704. doi: 10.1371/journal.pone.0005704.
90.	TLR2-dependent MyD88 signaling contributes to early host defense in murine Enterococcus faecium peritonitis.	Leendertse M, etal., J Immunol. 2008 Apr 1;180(7):4865-74.
91.	TLR4-mediated induction of TLR2 signaling is critical in the pathogenesis and resolution of otitis media.	Leichtle A, etal., Innate Immun. 2009 Aug;15(4):205-15. doi: 10.1177/1753425909103170. Epub 2009 Jul 8.
92.	[Potential role of JAK/STAT in regulating Toll-like receptor 2 gene expression in rats with postburn Staphylococcus aureus sepsis]	Li HY, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue 2003 Mar;15(3):139-42.
93.	[Toll-like receptor 2 and Toll-like receptor 4 participates in mediation of acute otitis media and mortality in pneumococcal infections in mice].	Li SL, etal., Zhonghua Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2011 Dec;46(12):1009-18.
94.	Quercetin attenuates the activation of hepatic stellate cells and liver fibrosis in mice through modulation of HMGB1-TLR2/4-NF-κB signaling pathways.	Li X, etal., Toxicol Lett. 2016 Nov 2;261:1-12. doi: 10.1016/j.toxlet.2016.09.002. Epub 2016 Sep 4.
95.	Cyclosporine-induced renal injury induces toll-like receptor and maturation of dendritic cells.	Lim SW, etal., Transplantation. 2005 Sep 15;80(5):691-9.
96.	Loss of immunity-supported senescence enhances susceptibility to hepatocellular carcinogenesis and progression in Toll-like receptor 2-deficient mice.	Lin H, etal., Hepatology. 2013 Jan;57(1):171-82. doi: 10.1002/hep.25991.
97.	Pre-Activation of Toll-Like Receptor 2 Enhances CD8+ T-Cell Responses and Accelerates Hepatitis B Virus Clearance in the Mouse Models.	Lin Y, etal., Front Immunol. 2018 Jun 29;9:1495. doi: 10.3389/fimmu.2018.01495. eCollection 2018.
98.	MicroRNA-29a mitigation of toll-like receptor 2 and 4 signaling and alleviation of obstructive jaundice-induced fibrosis in mice.	Lin YC, etal., Biochem Biophys Res Commun. 2018 Feb 12;496(3):880-886. doi: 10.1016/j.bbrc.2018.01.132. Epub 2018 Jan 31.
99.	Erythropoietin pretreatment exerts anti-inflammatory effects in hepatic ischemia/reperfusion-injured rats via suppression of the TLR2/NF-κB pathway.	Liu QS, etal., Transplant Proc. 2015 Mar;47(2):283-9. doi: 10.1016/j.transproceed.2014.10.045.
100.	Hepatocyte toll-like receptor 2 expression in vivo and in vitro: role of cytokines in induction of rat TLR2 gene expression by lipopolysaccharide.	Liu S, etal., Shock. 2000 Sep;14(3):361-5.
101.	Toll-like receptor 2 plays a critical role in the progression of atherosclerosis that is independent of dietary lipids.	Liu X, etal., Atherosclerosis. 2008 Jan;196(1):146-54. Epub 2007 Apr 26.
102.	Higher expression of Toll-like receptors 2, 3, 4, and 8 in ocular Behcet's disease.	Liu X, etal., Invest Ophthalmol Vis Sci. 2013 Sep 5;54(9):6012-7. doi: 10.1167/iovs.13-12159.
103.	Changes in intestinal Toll-like receptors and cytokines precede histological injury in a rat model of necrotizing enterocolitis.	Liu Y, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Sep;297(3):G442-50. Epub 2009 Jul 16.
104.	Relationship between expression of toll-like receptors 2/4 in dendritic cells and chronic hepatitis B virus infection.	Lu X, etal., Int J Clin Exp Pathol. 2014 Aug 15;7(9):6048-55. eCollection 2014.
105.	[Effects of antimicrobial agents on the Toll like receptors and myeloid differentiation protein-2 in liver tissue of alcohol-induced liver disease: experiment with rats]	Lu ZQ, etal., Zhonghua Yi Xue Za Zhi. 2009 Jan 13;89(2):138-41.
106.	Gut microbiota translocation promotes autoimmune cholangitis.	Ma HD, etal., J Autoimmun. 2018 Dec;95:47-57. doi: 10.1016/j.jaut.2018.09.010. Epub 2018 Oct 17.
107.	Association of Toll-like receptor (TLR) 2, 3 and 9 genes polymorphism with prostate cancer risk in North Indian population.	Mandal RK, etal., Mol Biol Rep. 2012 Jul;39(7):7263-9. doi: 10.1007/s11033-012-1556-5. Epub 2012 Feb 6.
108.	Toll-like receptors in rat brains injured by hypoxic-ischaemia or exposed to staphylococcal alpha-toxin.	Maslinska D, etal., Folia Neuropathol. 2004;42(3):125-32.
109.	Temperature- and time-dependent changes in TLR2-activated microglial NF-kappaB activity and concentrations of inflammatory and anti-inflammatory factors.	Matsui T, etal., Intensive Care Med. 2012 Aug;38(8):1392-9. doi: 10.1007/s00134-012-2591-3. Epub 2012 Jun 1.
110.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
111.	Saturated fatty acids produce an inflammatory response predominantly through the activation of TLR4 signaling in hypothalamus: implications for the pathogenesis of obesity.	Milanski M, etal., J Neurosci. 2009 Jan 14;29(2):359-70.
112.	In situ TLR2 and TLR4 expression in a murine model of mycetoma caused by Nocardia brasiliensis.	Millan-Chiu BE, etal., FEMS Immunol Med Microbiol. 2011 Apr;61(3):278-87. doi: 10.1111/j.1574-695X.2010.00775.x. Epub 2011 Jan 31.
113.	Deletion of Thioredoxin-interacting protein ameliorates high fat diet-induced non-alcoholic steatohepatitis through modulation of Toll-like receptor 2-NLRP3-inflammasome axis: Histological and immunohistochemical study.	Mohamed IN, etal., Acta Histochem. 2018 Apr;120(3):242-254. doi: 10.1016/j.acthis.2018.02.006. Epub 2018 Feb 23.
114.	A clinical association between Toll-like receptor 2 Arg753Gln polymorphism with recurrent cystic echinococcosis in postsurgery patients: A case control study.	Moradkhani MA, etal., Comp Immunol Microbiol Infect Dis. 2019 Oct;66:101336. doi: 10.1016/j.cimid.2019.101336. Epub 2019 Jul 24.
115.	Systemic activation of Toll-like receptor 2 suppresses mitochondrial respiration and exacerbates hypoxic-ischemic injury in the developing brain.	Mottahedin A, etal., J Cereb Blood Flow Metab. 2017 Apr;37(4):1192-1198. doi: 10.1177/0271678X17691292. Epub 2017 Jan 1.
116.	Respiratory syncytial virus activates innate immunity through Toll-like receptor 2.	Murawski MR, etal., J Virol. 2009 Feb;83(3):1492-500. Epub 2008 Nov 19.
117.	Regulatory actions of Toll-like receptor 2 (TLR2) and TLR4 in Leishmania donovani infection in the liver.	Murray HW, etal., Infect Immun. 2013 Jul;81(7):2318-26. doi: 10.1128/IAI.01468-12. Epub 2013 Apr 15.
118.	Involvement of innate immunity in the pathogenesis of intestinal Behcet's disease.	Nara K, etal., Clin Exp Immunol. 2008 May;152(2):245-51. doi: 10.1111/j.1365-2249.2008.03626.x. Epub 2008 Mar 10.
119.	The toll-like receptor 2 (TLR2) -196 to -174 del/ins polymorphism affects viral loads and susceptibility to hepatocellular carcinoma in chronic hepatitis C.	Nischalke HD, etal., Int J Cancer. 2012 Mar 15;130(6):1470-5. doi: 10.1002/ijc.26143. Epub 2011 Jun 18.
120.	Role of Toll-like receptor (TLR) 2 in experimental Bacillus cereus endophthalmitis.	Novosad BD, etal., PLoS One. 2011;6(12):e28619. doi: 10.1371/journal.pone.0028619. Epub 2011 Dec 6.
121.	Association of the toll-like receptor 2 A-16934T promoter polymorphism with severe atopic dermatitis.	Oh DY, etal., Allergy. 2009 Nov;64(11):1608-15. doi: 10.1111/j.1398-9995.2009.02066.x. Epub 2009 Jul 21.
122.	Enhanced expression of Toll-like receptor 2 in lesional tissues and peripheral blood monocytes of patients with oral lichen planus.	Ohno S, etal., J Dermatol. 2011 Apr;38(4):335-44.
123.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
124.	Toll-like receptor 2 gene polymorphisms in a Korean population: association with chronic rhinosinusitis.	Park CS, etal., Otolaryngol Head Neck Surg. 2011 Jan;144(1):96-100. doi: 10.1177/0194599810390881.
125.	Association of the polymorphism for Toll-like receptor 2 with type 1 diabetes susceptibility.	Park Y, etal., Ann N Y Acad Sci. 2004 Dec;1037:170-4.
126.	Toll-like receptor 2 is essential for the sensing of oxidants during inflammation.	Paul-Clark MJ, etal., Am J Respir Crit Care Med. 2009 Feb 15;179(4):299-306. Epub 2008 Nov 14.
127.	Combined Tlr2 and Tlr4 deficiency increases radiation-induced pulmonary fibrosis in mice.	Paun A, etal., Int J Radiat Oncol Biol Phys. 2010 Jul 15;77(4):1198-205.
128.	Surface TLR2 and TLR4 expression on mature rat mast cells can be affected by some bacterial components and proinflammatory cytokines.	Pietrzak A, etal., Mediators Inflamm. 2011;2011:427473. doi: 10.1155/2011/427473. Epub 2011 May 2.
129.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
130.	Toll-like receptor 2 deficiency is associated with enhanced severity of group B streptococcal disease.	Puliti M, etal., Infect Immun. 2009 Apr;77(4):1524-31. doi: 10.1128/IAI.00965-08. Epub 2009 Jan 29.
131.	Polymorphisms in the toll-like receptor 2 subfamily and risk of asthma: a case-control analysis in a Chinese population.	Qian FH, etal., J Investig Allergol Clin Immunol. 2010;20(4):340-6.
132.	Toll-like receptor expression and activation in mice with experimental dry eye.	Redfern RL, etal., Invest Ophthalmol Vis Sci. 2013 Feb 28;54(2):1554-63. doi: 10.1167/iovs.12-10739.
133.	GOA pipeline	RGD automated data pipeline
134.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
135.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
136.	Expression of toll-like receptors 2, 4 and 9 is increased in gingival tissue from patients with type 2 diabetes and chronic periodontitis.	Rojo-Botello NR, etal., J Periodontal Res. 2012 Feb;47(1):62-73. doi: 10.1111/j.1600-0765.2011.01405.x. Epub 2011 Aug 17.
137.	Nucleotide-binding oligomerization domain 2 and Toll-like receptor 2 function independently in a murine model of arthritis triggered by intraarticular peptidoglycan.	Rosenzweig HL, etal., Arthritis Rheum. 2010 Apr;62(4):1051-9. doi: 10.1002/art.27335.
138.	Toll-like receptors 2 and 4 in renal ischemia/reperfusion injury.	Rusai K, etal., Pediatr Nephrol. 2010 May;25(5):853-60. doi: 10.1007/s00467-009-1422-4. Epub 2010 Feb 4.
139.	TLR2 and TLR4 gene polymorphisms and atopic dermatitis in Italian children: a multicenter study.	Salpietro C, etal., Int J Immunopathol Pharmacol. 2011 Oct;24(4 Suppl):33-40.
140.	No association of TLR2 and TLR4 polymorphisms with type I diabetes mellitus in the Basque population.	Santin I, etal., Ann N Y Acad Sci. 2006 Oct;1079:268-72.
141.	Innate recognition network driving herpes simplex virus-induced corneal immunopathology: role of the toll pathway in early inflammatory events in stromal keratitis.	Sarangi PP, etal., J Virol. 2007 Oct;81(20):11128-38. Epub 2007 Aug 8.
142.	Expression of toll-like receptor 2 and 4 in intestinal mucosa in experimental severe acute pancreatitis.	Sawa H, etal., Hepatogastroenterology. 2008 Nov-Dec;55(88):2247-51.
143.	TLR2 and TLR4 expression in peripheral blood mononuclear cells of patients with chronic cystic echinococcosis and its relationship with IL-10.	Shan JY, etal., Parasite Immunol. 2011 Dec;33(12):692-6. doi: 10.1111/j.1365-3024.2011.01335.x.
144.	The role of TLR2 in nerve injury-induced neuropathic pain is essentially mediated through macrophages in peripheral inflammatory response.	Shi XQ, etal., Glia. 2011 Feb;59(2):231-41. doi: 10.1002/glia.21093.
145.	Mechanistic investigation of immunosuppression in patients with condyloma acuminata.	Shi YJ, etal., Mol Med Rep. 2013 Aug;8(2):480-6. doi: 10.3892/mmr.2013.1511. Epub 2013 Jun 6.
146.	[Differential expression of toll-like receptors in chronic suppurative otitis media and cholesteatoma].	Si Y, etal., Zhonghua Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2012 May;47(5):388-93.
147.	Intestinal epithelial barrier dysfunction and dendritic cell redistribution during early stages of inflammation in the rat: role for TLR-2 and -4 blockage.	Silva MA, etal., Inflamm Bowel Dis. 2008 May;14(5):632-44.
148.	Single-nucleotide Polymorphisms in Genes Encoding Toll-like Receptor -2, -3, -4, and -9 in a Case-Control Study with Bladder Cancer Susceptibility in a North Indian Population.	Singh V, etal., Arch Med Res. 2013 Jan;44(1):54-61. doi: 10.1016/j.arcmed.2012.10.008. Epub 2012 Nov 6.
149.	CD14 and toll-like receptor gene polymorphisms, country living, and asthma in adults.	Smit LA, etal., Am J Respir Crit Care Med. 2009 Mar 1;179(5):363-8. Epub 2008 Dec 18.
150.	Toll-like receptor 2 induces Th17 myeloperoxidase autoimmunity while Toll-like receptor 9 drives Th1 autoimmunity in murine vasculitis.	Summers SA, etal., Arthritis Rheum. 2011 Apr;63(4):1124-35. doi: 10.1002/art.30208.
151.	Biofilm formation and Toll-like receptor 2, Toll-like receptor 4, and NF-kappaB expression in sinus tissues of patients with chronic rhinosinusitis.	Sun Y, etal., Am J Rhinol Allergy. 2012 Mar-Apr;26(2):104-9. doi: 10.2500/ajra.2012.26.3718. Epub 2011 Dec 16.
152.	Staphylococcus aureus-induced corneal inflammation is dependent on Toll-like receptor 2 and myeloid differentiation factor 88.	Sun Y, etal., Infect Immun. 2006 Sep;74(9):5325-32.
153.	Association of TLR2 gene Arg753Gln polymorphism with urinary tract infection in children.	Tabel Y, etal., Int J Immunogenet. 2007 Dec;34(6):399-405.
154.	[Methylprednisolone enhances the expression of Toll-like receptor 2 on macrophages in induced sputum from patients with chronic cough].	Tang CW, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2011 Feb;34(2):123-7.
155.	Assessment of Toll-like receptor 2 gene polymorphisms in severe chronic rhinosinusitis.	Tewfik MA, etal., J Otolaryngol Head Neck Surg. 2008 Aug;37(4):552-8.
156.	Toll-like receptors gene polymorphisms may confer increased susceptibility to breast cancer development.	Theodoropoulos GE, etal., Breast. 2012 Aug;21(4):534-8. doi: 10.1016/j.breast.2012.04.001. Epub 2012 May 2.
157.	Association study of tumor necrosis factor receptor type 2 M196R and toll-like receptor 2 Arg753Gln polymorphisms with acne vulgaris in a Chinese Han ethnic group.	Tian LM, etal., Dermatology. 2010;221(3):276-84. doi: 10.1159/000319851.
158.	Enhanced immediate inflammatory response to Streptococcus pneumoniae in the lungs of mice with pulmonary emphysema.	Tokairin Y, etal., Respirology. 2008 May;13(3):324-32.
159.	Involvement of toll-like receptor 2 and 4 in association between dyslipidemia and osteoclast differentiation in apolipoprotein E deficient rat periodontium.	Tomofuji T, etal., Lipids Health Dis. 2013 Jan 8;12(1):1.
160.	Protective effects of curcumin against hepatic fibrosis induced by carbon tetrachloride: modulation of high-mobility group box 1, Toll-like receptor 4 and 2 expression.	Tu CT, etal., Food Chem Toxicol. 2012 Sep;50(9):3343-51. doi: 10.1016/j.fct.2012.05.050. Epub 2012 Jun 7.
161.	Modulation of immune signaling, bacterial clearance, and corneal integrity by toll-like receptors during streptococcus pneumoniae keratitis.	Tullos NA, etal., Curr Eye Res. 2013 Oct;38(10):1036-48. doi: 10.3109/02713683.2013.804094. Epub 2013 Jul 10.
162.	The expression of TLR2, TLR4 and TLR9 in the epidermis of patients with cutaneous leishmaniasis.	Tuon FF, etal., J Dermatol Sci. 2010 Jul;59(1):55-7. doi: 10.1016/j.jdermsci.2010.04.009. Epub 2010 May 20.
163.	Polymorphisms in Toll-like receptors 2, 4, and 9 are highly associated with hearing loss in survivors of bacterial meningitis.	van Well GT, etal., PLoS One. 2012;7(5):e35837. doi: 10.1371/journal.pone.0035837. Epub 2012 May 25.
164.	Single nucleotide polymorphisms in pathogen recognition receptor genes are associated with susceptibility to meningococcal meningitis in a pediatric cohort.	van Well GT, etal., PLoS One. 2013 May 14;8(5):e64252. doi: 10.1371/journal.pone.0064252. Print 2013.
165.	Reduction of TLR2 gene expression in allergic and nonallergic rhinitis.	Vanhinsbergh LJ, etal., Ann Allergy Asthma Immunol. 2007 Dec;99(6):509-16. doi: 10.1016/S1081-1206(10)60379-1.
166.	Association of SLC11A1 with tuberculosis and interactions with NOS2A and TLR2 in African-Americans and Caucasians.	Velez DR, etal., Int J Tuberc Lung Dis. 2009 Sep;13(9):1068-76.
167.	[Expression of toll-like receptor mRNA in epithelial cell of nasal mucosa].	Wang CS and Dong Z, Zhonghua Er Bi Yan Hou Ke Za Zhi. 2003 Aug;38(4):243-6.
168.	Recipient Toll-like receptors contribute to chronic graft dysfunction by both MyD88- and TRIF-dependent signaling.	Wang S, etal., Dis Model Mech. 2010 Jan-Feb;3(1-2):92-103. doi: 10.1242/dmm.003533. Epub 2009 Dec 28.
169.	Decreased inflammatory response in Toll-like receptor 2 knockout mice is associated with exacerbated Pneumocystis pneumonia.	Wang SH, etal., Microbes Infect. 2008 Apr;10(4):334-41. Epub 2007 Dec 28.
170.	Fever induction by systemic stimulation with macrophage-activating lipopeptide-2 depends upon TLR2 but not CD36.	Welsch J, etal., Innate Immun. 2012 Jun;18(3):541-59. doi: 10.1177/1753425911426892. Epub 2011 Oct 31.
171.	No evidence of altered alveolar macrophage polarization, but reduced expression of TLR2, in bronchoalveolar lavage cells in sarcoidosis.	Wiken M, etal., Respir Res. 2010 Sep 2;11:121.
172.	In vivo expression of Toll-like receptor 2 and 4 by renal epithelial cells: IFN-gamma and TNF-alpha mediated up-regulation during inflammation.	Wolfs TG, etal., J Immunol. 2002 Feb 1;168(3):1286-93.
173.	Effect of nitric oxide on toll-like receptor 2 and 4 gene expression in rats with acute lung injury complicated by acute hemorrhage necrotizing pancreatitis.	Wu HS, etal., Hepatobiliary Pancreat Dis Int. 2005 Nov;4(4):609-13.
174.	Toll-like receptor 2 down-regulation in established mouse allergic lungs contributes to decreased mycoplasma clearance.	Wu Q, etal., Am J Respir Crit Care Med. 2008 Apr 1;177(7):720-9. Epub 2008 Jan 17.
175.	Microsatellite polymorphisms in intron 2 of the toll-like receptor 2 gene and their association with susceptibility to pulmonary tuberculosis in Han Chinese.	Xue Y, etal., Clin Chem Lab Med. 2010 Jun;48(6):785-9.
176.	Targeting TLR2 attenuates pulmonary inflammation and fibrosis by reversion of suppressive immune microenvironment.	Yang HZ, etal., J Immunol. 2009 Jan 1;182(1):692-702.
177.	Different expression of dectin-1 and Toll-like receptor 2 in the lungs of different immune status mice infected with Aspergillus fumigatus.	Yang JX, etal., Chin Med J (Engl). 2009 Sep 5;122(17):2017-21.
178.	TLR2 signal influences the iNOS/NO responses and worm development in C57BL/6J mice infected with Clonorchis sinensis.	Yang QL, etal., Parasit Vectors. 2017 Aug 7;10(1):379. doi: 10.1186/s13071-017-2318-y.
179.	[Changes in Toll-like receptor 2 and 4 gene expression in vital organs in septic rats and their regulation mechanisms]	Yao YM, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2003 Nov;15(11):646-50.
180.	Association between microsatellite polymorphisms in intron II of the human Toll-like receptor 2 gene and nontuberculous mycobacterial lung disease in a Korean population.	Yim JJ, etal., Hum Immunol. 2008 Sep;69(9):572-6. Epub 2008 Jul 3.
181.	Toll-Like receptor 2 (TLR2) and TLR9 play opposing roles in host innate immunity against Salmonella enterica serovar Typhimurium infection.	Zhan R, etal., Infect Immun. 2015 Apr;83(4):1641-9. doi: 10.1128/IAI.02870-14. Epub 2015 Feb 9.
182.	Protection against hepatic ischemia/reperfusion injury via downregulation of toll-like receptor 2 expression by inhibition of Kupffer cell function.	Zhang JX, etal., World J Gastroenterol. 2005 Jul 28;11(28):4423-6. doi: 10.3748/wjg.v11.i28.4423.
183.	[Effect of nitric oxide on Toll-like receptor 2/4 gene expression in the liver in acute hemorrhagic necrotizing pancreatitis in rats]	Zhang L, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2006 Mar;18(3):161-4.
184.	Toll-like receptor-2, CD14 and heat-shock protein 70 in inflammatory lesions of rat experimental autoimmune neuritis.	Zhang ZY, etal., Neuroscience. 2009 Mar 3;159(1):136-42. Epub 2009 Jan 1.
185.	Effects of Fufang Shenhua Tablet on the expression of toll-like receptors during acute kidney injury induced by ischemia-reperfusion in rats.	Zheng XY, etal., Chin J Integr Med. 2012 Dec;18(12):918-24. doi: 10.1007/s11655-012-1295-1. Epub 2012 Dec 13.
186.	A synthetic Toll-like receptor 2 ligand decreases allergic immune responses in a mouse rhinitis model sensitized to mite allergen.	Zhou C, etal., J Zhejiang Univ Sci B. 2008 Apr;9(4):279-85. doi: 10.1631/jzus.B0730029.
187.	Induction of toll-like receptor 2 positive antigen-presenting cells in spleen of pristane-induced arthritis in rats.	Zhu W, etal., Mol Biol Rep. 2012 Apr;39(4):3667-73. doi: 10.1007/s11033-011-1141-3. Epub 2011 Jul 3.
188.	Increase in peripheral blood mononuclear cell Toll-like receptor 2/3 expression and reactivity to their ligands in a cohort of patients with wet age-related macular degeneration.	Zhu Y, etal., Mol Vis. 2013 Aug 6;19:1826-33. eCollection 2013.
189.	[Effects of vasoactive intestinal peptide on Toll-like receptor (TLR) 2 mRNA and TLR4 mRNA expression on acute lung injury induced by lipopolysach aride in rat]	Zuo WQ, etal., Zhonghua Er Ke Za Zhi. 2010 Jan;48(1):19-23.

Additional References at PubMed

PMID:10384090	PMID:10549626	PMID:11067888	PMID:11274165	PMID:11521063	PMID:11672593	PMID:11986301	PMID:12091878	PMID:12443841	PMID:12594207	PMID:12719478	PMID:15220916
PMID:15294986	PMID:15356140	PMID:15690042	PMID:16177377	PMID:16489656	PMID:16601243	PMID:16879708	PMID:16880211	PMID:16949315	PMID:16954392	PMID:17027917	PMID:17053043
PMID:17114491	PMID:17128265	PMID:17417665	PMID:17460566	PMID:17600044	PMID:17889651	PMID:17971865	PMID:18204298	PMID:18261938	PMID:18319620	PMID:18592153	PMID:19047410
PMID:19115402	PMID:19139201	PMID:19326394	PMID:19454685	PMID:19509287	PMID:19527807	PMID:19740627	PMID:19770268	PMID:19861264	PMID:19930876	PMID:19931471	PMID:20020500
PMID:20023008	PMID:20113783	PMID:20421349	PMID:20441518	PMID:20534434	PMID:20628242	PMID:20665543	PMID:20717659	PMID:20945380	PMID:21109260	PMID:21343866	PMID:21618349
PMID:21870333	PMID:21875662	PMID:22033934	PMID:22067617	PMID:22099754	PMID:22198949	PMID:22242189	PMID:22402367	PMID:22523073	PMID:23155421	PMID:23447644	PMID:23656243
PMID:23817958	PMID:23826189	PMID:24082081	PMID:24091496	PMID:24423688	PMID:24660535	PMID:24846408	PMID:24871424	PMID:24966901	PMID:25224460	PMID:25465639	PMID:25530127
PMID:25534427	PMID:25780291	PMID:25800037	PMID:25931256	PMID:25990971	PMID:26436391	PMID:26475712	PMID:26477714	PMID:26649771	PMID:26744383	PMID:26898123	PMID:26962463
PMID:27107801	PMID:27108485	PMID:27312383	PMID:27391866	PMID:28078022	PMID:28243080	PMID:28257481	PMID:28293064	PMID:28432060	PMID:28822965	PMID:28889066	PMID:29536648
PMID:30031930	PMID:30107238	PMID:30222725	PMID:30480410	PMID:31002842	PMID:31678237	PMID:32377693	PMID:32384574	PMID:32634389	PMID:32879625	PMID:33652137	PMID:34015428
PMID:35322444	PMID:36972303

Genomics

Comparative Map Data

Tlr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	169,200,620 - 169,206,819 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	169,197,419 - 169,206,630 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	176,379,970 - 176,385,353 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	174,399,903 - 174,405,286 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	169,001,363 - 169,006,752 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	182,840,171 - 182,846,061 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	182,840,727 - 182,846,061 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	202,252,701 - 202,258,962 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	175,607,990 - 175,613,992 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	175,558,096 - 175,564,098 (-)	NCBI
Celera	2	163,202,040 - 163,207,399 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

TLR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	153,684,280 - 153,710,637 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	153,684,070 - 153,706,260 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	154,605,432 - 154,627,412 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	154,824,891 - 154,846,693 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	154,966,670 - 154,984,135	NCBI
Celera	4	151,929,928 - 151,951,730 (+)	NCBI		Celera
Cytogenetic Map	4	q31.3	NCBI
HuRef	4	150,336,457 - 150,358,268 (+)	NCBI		HuRef
CHM1_1	4	154,583,811 - 154,605,614 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	157,008,777 - 157,030,716 (+)	NCBI		T2T-CHM13v2.0

Tlr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	83,743,579 - 83,749,045 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	83,743,579 - 83,749,074 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	83,836,272 - 83,841,824 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	83,836,272 - 83,841,767 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	83,640,194 - 83,645,530 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	83,922,199 - 83,927,694 (-)	NCBI		MGSCv36	mm8
Celera	3	83,852,064 - 83,857,400 (-)	NCBI		Celera
Cytogenetic Map	3	E3	NCBI
cM Map	3	37.4	NCBI

Tlr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955471	8,014,910 - 8,017,258 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955471	8,011,710 - 8,019,063 (+)	NCBI	ChiLan1.0	ChiLan1.0

TLR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	151,924,943 - 151,949,250 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	146,024,653 - 146,091,388 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	157,848,058 - 157,870,324 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	157,866,977 - 157,869,331 (+)	Ensembl	panpan1.1		panPan2

TLR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	51,454,557 - 51,465,429 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	51,454,695 - 51,465,241 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	51,808,717 - 51,811,083 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	52,140,775 - 52,151,566 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	15	51,404,786 - 51,407,152 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	51,510,608 - 51,512,974 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	51,821,784 - 51,824,151 (+)	NCBI		UU_Cfam_GSD_1.0

Tlr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	39,016,995 - 39,024,812 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936576	527,434 - 529,788 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936576	522,234 - 531,660 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TLR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	75,411,993 - 75,428,330 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	75,416,257 - 75,428,370 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	79,823,867 - 79,834,881 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TLR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	100,239,533 - 100,565,955 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	100,258,441 - 100,260,795 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	79,891,761 - 79,956,832 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tlr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624858	4,979,485 - 4,981,833 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624858	4,931,820 - 4,984,175 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tlr2
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	103
Interacting mature miRNAs:	108
Transcripts:	ENSRNOT00000013025
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat

Markers in Region

RH144365

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	169,201,531 - 169,201,724 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	182,841,083 - 182,841,275	NCBI	Rnor6.0
Rnor_5.0	2	202,253,613 - 202,253,805	UniSTS	Rnor5.0
RGSC_v3.4	2	175,608,347 - 175,608,539	UniSTS	RGSC3.4
Celera	2	163,202,397 - 163,202,589	UniSTS
RH 3.4 Map	2	1105.2	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			8		19						3	5
Low	3	43	45	37		37	8	10	74	35	34	6	8
Below cutoff			4	4		4		1			3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY151255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY151256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF127847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF127848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730211	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730213	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730227	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730230	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MT730240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000013025 ⟹ ENSRNOP00000013025

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	169,198,149 - 169,206,630 (-)	Ensembl
Rnor_6.0 Ensembl	2	182,840,727 - 182,846,061 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097289 ⟹ ENSRNOP00000095767

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	169,197,419 - 169,206,630 (-)	Ensembl

RefSeq Acc Id:

NM_198769 ⟹ NP_942064

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	169,201,175 - 169,206,545 (-)	NCBI
Rnor_6.0	2	182,840,726 - 182,846,061 (-)	NCBI
Rnor_5.0	2	202,252,701 - 202,258,962 (-)	NCBI
RGSC_v3.4	2	175,607,990 - 175,613,992 (-)	RGD
Celera	2	163,202,040 - 163,207,399 (-)	RGD

Sequence:

show sequence

GCCCAGATGGCCACAGGACTCAAGAGCATCGGCTGGAGGTCTCCAGGTCAAATCTCAGAGGATG
CTGCAAGCTCTTTGGCTCTTCTGGATCTTGATGGCTGTGATAGGCCTCTCAAGGGAAGGCCATT
CTGCCCAGGCATCTCTGTCATGTGATGCTGCTGGTGTGTGTGATGGCAGCTCCAGGTCTTTCAC
CTCTATTCCCTCGGGACTCACAGCAAACACAAAGAAGCTTGACCTGTCTTTCAACAAGATCACC
TACATTGGCCATGGTGACTTGCGAGCCTGTGTGAACCTCCGGGTTCTGACATTGGAGTCCAGCG
GAATCAACACAATAGAGGGAGATGCCTTTTATTCTCTGGGCAGTCTTGAACACTTGGACTTGTC
TAATAATCACCTATCTAGTTTATCTTCCTCCTGGTTCAGGCCCCTTTCCTCTTTGAAATACTTA
AACTTAATGGGAAATCCTTACAGGACACTGGGGGAAACATCACTGTTCTCCAATCTCACAAATT
TACAAACCCTTAGGGTAGGAAATGTTGACACTTTCAGTGAGATAAGGAGAATAGATTTTGCTGG
GCTGACCTCTCTCAACGAACTTGAAATTCAGGTATTAAGTCTCGGCAACTATGAGTCCCGAAGT
CTACAGTCAATTAGAGACATCTATCACCTGACCCTGCACTTGAGCGAGTCTGCTTTCCTGCTGG
GGATTTTTGCAGATATTCTGAGTTCCGTGAGATATTTAGAACTAAGAGATACTAACTTGGCTAG
GTTCCAATTTTCTGAACTGTCTGTAGACGAAATCAATTCGCCAATGAAGAAGCTGGCATTCCGG
AATGCAGATCTCACCGATAAAAGTTTTAATGAACTCCTGAAGCTGTTGCGTTACATCTTGGAAC
TGATGGAGGTGGAGTTTGATCACTGCACCCTCAATGGGGTTGGTAATTTCAACCCCTCAGAGTC
AGACGTAGTGAGGGAGCTAGGTAAAGTAGAAACGGTAACAATACGGAGCCTGCACATCCCCCAG
TTCTATTTGTTCTATGATCTGAGCACTGTGTATTCCCTCCTGGAGAAAGTGAAGCGAATCACAG
TAGAGAACAGTAAGGTCTTTCTGGTTCCCTGCTCTTTCTCACAGCATTTAAAATCATTAGAGTT
CTTAGACCTCAGCGAAAATCTGATGGTTGAAGAGTATTTGAAAAACTCAGCCTGTGAGGGTGGC
TGGCCTTCTCTACAAAGCTTGGTTTTGAGTCAGAATCATTTGAGATCAATACGAAAAACTGCTG
AGATTTTGCTGACTCTGAAAAACCTGACAGCCCTTGACATCAGCAAGAACAGTTTTCAGCCTAT
GCCCGACAGTTGTCAGTGGCCAGGAAAGATGCGCTTCCTGAACTTGTCCAGTACAGGGATACAG
GCCGTCAAGACATGCATTCCTCAGACCCTGGAGGTGTTGGATGTTAGTAACAACAATCTCGATT
CATTTTCTTTGTTTTTGCCTCGGCTCCAAGAGCTGTATATTTCCAGAAATAAACTGAAGACACT
CCCAGAAGCTTCATTGTTCCCTGTGTTACAGGTCATGAAGATCAGAGAGAACGCAATAAGTACT
TTCTCTAAAGACCAGCTTGGTTCTTTTCCCAAACTGGAGACTCTGGAAGCAGGTGACAACCATT
TCATCTGCTCCTGTGAACTCCTGTCCTTCATTCTGGAGAGGCCAGCCCTGGTCCATGTCCTGGT
TGACTGGCCAGACAGCTACCTGTGTGATTCTCCGCCTCGCCTGCATGGCCAGAGGCTTCAGGAT
GCCCGGCCCTCAGTCTTGGAGTGTCACCAGGCCGCACTGGTCTCTGGAGTCTGCTGTGCCCTTC
TCCTGTTGATCCTGCTCTTAGGCGCCCTGTGTTACCATTTCCATGGGCTGTGGTATCTGAGAAT
GATGTGGGCGTGGCTCCGGGCCAAGAGGAAGCCCAAGAAAGCTCCTTGCAGGGACCTTTGCTAT
GATGCCTTTGTTTCCTACAGCGAGCAGGATTCCTATTGGGTGGAGAACCTCATGGTCCAGCAGC
TGGAGAACTCTGACCCACCCTTCAAGCTGTGTCTCCACAAGCGGGACTTTGTTCCGGGCAAATG
GATCATTGACAACATCATTGATTCCATCGAAAAGAGCCACAAAACTGTGTTCGTGCTTTCTGAG
AACTTCGTACGCAGTGAGTGGTGCAAGTATGAACTGGACTTCTCCCACTTCAGGCTCTTTGACG
AGAACAATGACGCGGCCATCCTTGTTTTGCTGGAACCCATTGAGAAGAAAGCCATTCCCCAGCG
CTTCTGCAAACTGCGCAAGATAATGAACACTAAGACATACCTGGAGTGGCCCTTGGATGAAGGC
CAGCGGGAAGTGTTTTGGGCAAATCTGAGAACTGCAATAAAATCCTAGGTTCTCCACCCTGTTT
CTGTCTTGCCTTAACTAAAGGTCTTTGTGACAGGAACTGTAACAAAGTTTATTCTGACATAATT
ATATAAGTATCATAGAATTGTACTACTGAGGATTTGGTAAGTATAACTAGTAACTATGAGCTTT
ATCTTGAATACTGTTATATAAATATTTGACATCAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008761102 ⟹ XP_008759324

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	169,200,620 - 169,206,819 (-)	NCBI
Rnor_6.0	2	182,840,171 - 182,846,006 (-)	NCBI

Sequence:

show sequence

TGGTTCGTTCCCGCTGCTGAGTCGCTGCACCCCTCCCTGGGCAGGGTCGGAGCGACGGGGCGGT
CGCTGTGCCTCTGCGTTGGCGGGGACCTGGTTCCCAACAAGAAGCACCTGCGCCCGGAGCCGGG
CGGCTCAGCTTTGAAGACCAGTGTTTCTAGCTGCAGTCCCAGTCTAAGCTTTGGGGCCAGAAGT
TTCCAGCTGTGATCCCTGCAGGAAGAGGGACAGCCAGAGAGGTTAGGGGCACCGCAGAGCTGCA
GCCACTGTCCCGGAGCCCGTCGCTGTGTGACCGGCACCTTTACAGGCTTTCTGGCCCCAGGGTC
ACAGAGGGGAACATCCGTAGTGCCCCTCAACCTTGGGGCGCTCAGGGTGACAGTGGCGCCGTCC
TAATTAACCTCCAGCCCACCCCTGTGGTCCCCAGTCTCAGGGCAGGCGGTCACTTGCAGGGGGT
GTGTCTGCAATCATAGTTTCGAATGGTGATGTTTGGACAGCAGTGGAAAAGATGTCATTCGAGG
AGGTGCAGACTGCTTCCTTCTGACCAGGATCTTGTTTCTGAGTGTAGGGGCTTCACTTCTCTGC
TTTTCATTTATCTCTGGAGCATCGGAATTGCATCTCTGGTCAGAAACCGCCTTATGGAAACTGC
AAAGAGTCAAATCTCAGAGGATGCTGCAAGCTCTTTGGCTCTTCTGGATCTTGATGGCTGTGAT
AGGCCTCTCAAGGGAAGGCCATTCTGCCCAGGCATCTCTGTCATGTGATGCTGCTGGTGTGTGT
GATGGCAGCTCCAGGTCTTTCACCTCTATTCCCTCGGGACTCACAGCAAACACAAAGAAGCTTG
ACCTGTCTTTCAACAAGATCACCTACATTGGCCATGGTGACTTGCGAGCCTGTGTGAACCTCCG
GGTTCTGACATTGGAGTCCAGCGGAATCAACACAATAGAGGGAGATGCCTTTTATTCTCTGGGC
AGTCTTGAACACTTGGACTTGTCTAATAATCACCTATCTAGTTTATCTTCCTCCTGGTTCAGGC
CCCTTTCCTCTTTGAAATACTTAAACTTAATGGGAAATCCTTACAGGACACTGGGGGAAACATC
ACTGTTCTCCAATCTCACAAATTTACAAAACCTTAGGGTAGGAAATGTTGACACTTTCAGTGAG
ATAAGGAGAATAGATTTTGCTGGGCTGACCTCTCTCAACGAACTTGAAATTCAGGTATTAAGTC
TCGGCAACTATGAGTCCCGAAGTCTACAGTCAATTAGAGACATCTATCACCTGACCCTGCACTT
GAGCGAGTCTGCTTTCCTGCTGGGGATTTTTGCAGATATTCTGAGTTCCGTGAGATATTTAGAA
CTAAGAGATACTAACTTGGCTAGGTTCCAATTTTCTGAACTGTCTGTAGACGAAATCAATTCGC
CAATGAAGAAGCTGGCATTCCGGAATGCAGATCTCACCGATAAAAGTTTTAATGAACTCCTGAA
GCTGTTGCGTTACATCTTGGAACTGATGGAGGTGGAGTTTGATCACTGCACCCTCAATGGGGTT
GGTAATTTCAACCCCTCAGAGTCAGACGTAGTGAGGGAGCTAGGTAAAGTAGAAACGGTAACAA
TACGGAGCCTGCACATCCCCCAGTTCTATTTGTTCTATGATCTGAGCACTGTGTATTCCCTCCT
GGAGAAAGTGAAGCGAATCACAGTAGAGAACAGTAAGGTCTTTCTGGTTCCCTGCTCTTTCTCA
CAGCATTTAAAATCATTAGAGTTCTTAGACCTCAGCGAAAATCTGATGGTTGAAGAGTATTTGA
AAAACTCAGCCTGTGAGGGTGGCTGGCCTTCTCTACAAAGCTTGGTTTTGAGTCAGAATCATTT
GAGATCAATACGAAAAACTGCTGAGATTTTGCTGACTCTGAAAAACCTGACAGCCCTTGACATC
AGCAAGAACAGTTTTCAGCCTATGCCCGACAGTTGTCAGTGGCCAGGAAAGATGCGCTTCCTGA
ACTTGTCCAGTACAGGGATACAGGCCGTCAAGACATGCATTCCTCAGACCCTGGAGGTGTTGGA
TGTTAGTAACAACAATCTCGATTCATTTTCTTTGTTTTTGCCTCGGCTCCAAGAGCTGTATATT
TCCAGAAATAAACTGAAGACACTCCCAGAAGCTTCATTGTTCCCTGTGTTACAGGTCATGAAGA
TCAGAGAGAACGCAATAAGTACTTTCTCTAAAGACCAGCTTGGTTCTTTTCCCAAACTGGAGAC
TCTGGAAGCAGGTGACAACCATTTCATCTGCTCCTGTGAACTCCTGTCCTTCATTCTGGAGAGG
CCAGCCCTGGTCCATGTCCTGGTTGACTGGCCAGACAGCTACCTGTGTGATTCTCCGCCTCGCC
TGCATGGCCAGAGGCTTCAGGATGCCCGGCCCTCAGTCTTGGAGTGTCACCAGGCCGCACTGGT
CTCTGGAGTCTGCTGTGCCCTTCTCCTGTTGATCCTGCTCTTAGGCGCCCTGTGTTACCATTTC
CATGGGCTGTGGTATCTGAGAATGATGTGGGCGTGGCTCCGGGCCAAGAGGAAGCCCAAGAAAG
CTCCTTGCAGGGACCTTTGCTATGATGCCTTTGTTTCCTACAGCGAGCAGGATTCCTATTGGGT
GGAGAACCTCATGGTCCAGCAGCTGGAGAACTCTGACCCACCCTTCAAGCTGTGTCTCCACAAG
CGGGACTTTGTTCCGGGCAAATGGATCATTGACAACATCATTGATTCCATCGAAAAGAGCCACA
AAACAGTGTTCGTGCTTTCTGAGAACTTCGTACGCAGTGAGTGGTGCAAGTATGAACTGGACTT
CTCCCACTTCAGGCTCTTTGACGAGAACAATGACGCGGCCATCCTTGTTTTGCTGGAACCCATT
GAGAAGAAAGCCATTCCCCAGCGCTTCTGCAAACTGCGCAAGATAATGAACACTAAGACATACC
TGGAGTGGCCCTTGGATGAAGGCCAGCGGGAAGTGTTTTGGGCAAATCTGAGAACTGCAATAAA
ATCCTAGGTTCTCCACCCTGTTTCTGTCTTGCCTTAACTAAAGGTCTTTGTGACAGGAACTGTA
ACAAAGTTTATTCTGACATAATTATATAAGTATCATAGAATTGTACTACTGAGGATTTGGTAAG
TATAACTAGTAACTATGAGCTTTATCTTGAATACTGTTATATAAATATTTGACATCAGTTTCTC
TGTTTTTCTTTATCTTTCTCCATTATTGCTATCTGAATAACCTGTTCACTTAGAGCATCTGGAA
ATGGTACATGTAGAAAGATGGTTTAATGCCTATTATTTAATGCCCAGGCAGTGTGACATAGGGT
CACAGAAAGTATTTCCTAATCTACTCACCTGCCATCCCTCCGTGCAGCTGATATCAAGAGTAAG
GAGTCACGATATTTGGGGCATCTAGGCAAATCTCTTGCTATTCCTAGAGAGGGGGTTGTATCCC
ACCATCCCCTCAGACCTTCCAGTACAAATGACACAAGCTGCAAAACTAGGCTTGTTTGTCTGAG
TATTTGATAGTTTTCTCTAAGTATGAATTAAATGTTGATTTGTAAGGATCTGGTGCAGATTCCC
ACTGGACTTTAGCTCTGAATTTCCAGTGACTGGTTGCTGTGGCTCCTGATCCCCTTGGATGTTC
TGTTGCCTTTTTTCCTGTGCAGGGTCTCATTTGTAATTCTATAAAGCTTTTCTTTGCCTGTATG
GAAAAAATACATGTGTGCAAAAGATTTTTAAAGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_942064	(Get FASTA)	NCBI Sequence Viewer
	XP_008759324	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAN86524	(Get FASTA)	NCBI Sequence Viewer
	AAN86525	(Get FASTA)	NCBI Sequence Viewer
	ABL75415	(Get FASTA)	NCBI Sequence Viewer
	ABL75416	(Get FASTA)	NCBI Sequence Viewer
	EDM00832	(Get FASTA)	NCBI Sequence Viewer
	QQJ42660	(Get FASTA)	NCBI Sequence Viewer
	QQJ42661	(Get FASTA)	NCBI Sequence Viewer
	QQJ42662	(Get FASTA)	NCBI Sequence Viewer
	QQJ42663	(Get FASTA)	NCBI Sequence Viewer
	QQJ42664	(Get FASTA)	NCBI Sequence Viewer
	QQJ42665	(Get FASTA)	NCBI Sequence Viewer
	QQJ42666	(Get FASTA)	NCBI Sequence Viewer
	QQJ42667	(Get FASTA)	NCBI Sequence Viewer
	QQJ42668	(Get FASTA)	NCBI Sequence Viewer
	QQJ42669	(Get FASTA)	NCBI Sequence Viewer
	QQJ42670	(Get FASTA)	NCBI Sequence Viewer
	QQJ42671	(Get FASTA)	NCBI Sequence Viewer
	QQJ42672	(Get FASTA)	NCBI Sequence Viewer
	QQJ42673	(Get FASTA)	NCBI Sequence Viewer
	QQJ42674	(Get FASTA)	NCBI Sequence Viewer
	QQJ42675	(Get FASTA)	NCBI Sequence Viewer
	QQJ42676	(Get FASTA)	NCBI Sequence Viewer
	QQJ42677	(Get FASTA)	NCBI Sequence Viewer
	QQJ42678	(Get FASTA)	NCBI Sequence Viewer
	QQJ42679	(Get FASTA)	NCBI Sequence Viewer
	QQJ42680	(Get FASTA)	NCBI Sequence Viewer
	QQJ42681	(Get FASTA)	NCBI Sequence Viewer
	QQJ42682	(Get FASTA)	NCBI Sequence Viewer
	QQJ42683	(Get FASTA)	NCBI Sequence Viewer
	QQJ42684	(Get FASTA)	NCBI Sequence Viewer
	QQJ42685	(Get FASTA)	NCBI Sequence Viewer
	QQJ42686	(Get FASTA)	NCBI Sequence Viewer
	QQJ42687	(Get FASTA)	NCBI Sequence Viewer
	QQJ42688	(Get FASTA)	NCBI Sequence Viewer
	QQJ42689	(Get FASTA)	NCBI Sequence Viewer
	QQJ42690	(Get FASTA)	NCBI Sequence Viewer
	QQJ42691	(Get FASTA)	NCBI Sequence Viewer
	QQJ42692	(Get FASTA)	NCBI Sequence Viewer
	QQJ42693	(Get FASTA)	NCBI Sequence Viewer
	QQJ42694	(Get FASTA)	NCBI Sequence Viewer
	QQJ42695	(Get FASTA)	NCBI Sequence Viewer
	QQJ42696	(Get FASTA)	NCBI Sequence Viewer
	QQJ42697	(Get FASTA)	NCBI Sequence Viewer
	QQJ42698	(Get FASTA)	NCBI Sequence Viewer
	QQJ42699	(Get FASTA)	NCBI Sequence Viewer
	QQJ42700	(Get FASTA)	NCBI Sequence Viewer
	QQJ42701	(Get FASTA)	NCBI Sequence Viewer
	QQJ42702	(Get FASTA)	NCBI Sequence Viewer
	QQJ42703	(Get FASTA)	NCBI Sequence Viewer
	QQJ42704	(Get FASTA)	NCBI Sequence Viewer
	QQJ42705	(Get FASTA)	NCBI Sequence Viewer
	QQJ42706	(Get FASTA)	NCBI Sequence Viewer
	QQJ42707	(Get FASTA)	NCBI Sequence Viewer
	QQJ42708	(Get FASTA)	NCBI Sequence Viewer
	QQJ42709	(Get FASTA)	NCBI Sequence Viewer
	QQJ42710	(Get FASTA)	NCBI Sequence Viewer
	QQJ42711	(Get FASTA)	NCBI Sequence Viewer
	QQJ42712	(Get FASTA)	NCBI Sequence Viewer
	QQJ42713	(Get FASTA)	NCBI Sequence Viewer
	QQJ42714	(Get FASTA)	NCBI Sequence Viewer
	QQJ42715	(Get FASTA)	NCBI Sequence Viewer
	QQJ42716	(Get FASTA)	NCBI Sequence Viewer
	QQJ42717	(Get FASTA)	NCBI Sequence Viewer
	QQJ42718	(Get FASTA)	NCBI Sequence Viewer
	QQJ42719	(Get FASTA)	NCBI Sequence Viewer
	QQJ42720	(Get FASTA)	NCBI Sequence Viewer
	QQJ42721	(Get FASTA)	NCBI Sequence Viewer
	QQJ42722	(Get FASTA)	NCBI Sequence Viewer
	QQJ42723	(Get FASTA)	NCBI Sequence Viewer
	QQJ42724	(Get FASTA)	NCBI Sequence Viewer
	QQJ42725	(Get FASTA)	NCBI Sequence Viewer
	QQJ42726	(Get FASTA)	NCBI Sequence Viewer
	QQJ42727	(Get FASTA)	NCBI Sequence Viewer
	QQJ42728	(Get FASTA)	NCBI Sequence Viewer
	QQJ42729	(Get FASTA)	NCBI Sequence Viewer
	QQJ42730	(Get FASTA)	NCBI Sequence Viewer
	QQJ42731	(Get FASTA)	NCBI Sequence Viewer
	QQJ42732	(Get FASTA)	NCBI Sequence Viewer
	QQJ42733	(Get FASTA)	NCBI Sequence Viewer
	QQJ42734	(Get FASTA)	NCBI Sequence Viewer
	QQJ42735	(Get FASTA)	NCBI Sequence Viewer
	QQJ42736	(Get FASTA)	NCBI Sequence Viewer
	QQJ42737	(Get FASTA)	NCBI Sequence Viewer
	QQJ42738	(Get FASTA)	NCBI Sequence Viewer
	QQJ42739	(Get FASTA)	NCBI Sequence Viewer
	QQJ42740	(Get FASTA)	NCBI Sequence Viewer
	QQJ42741	(Get FASTA)	NCBI Sequence Viewer
	QQJ42742	(Get FASTA)	NCBI Sequence Viewer
	QQJ42743	(Get FASTA)	NCBI Sequence Viewer
	QQJ42744	(Get FASTA)	NCBI Sequence Viewer
	QQJ42745	(Get FASTA)	NCBI Sequence Viewer
	QQJ42746	(Get FASTA)	NCBI Sequence Viewer
	QQJ42747	(Get FASTA)	NCBI Sequence Viewer
	QQJ42748	(Get FASTA)	NCBI Sequence Viewer
	QQJ42749	(Get FASTA)	NCBI Sequence Viewer
	QQJ42750	(Get FASTA)	NCBI Sequence Viewer
	QQJ42751	(Get FASTA)	NCBI Sequence Viewer
	QQJ42752	(Get FASTA)	NCBI Sequence Viewer
	QQJ42753	(Get FASTA)	NCBI Sequence Viewer
	QQJ42754	(Get FASTA)	NCBI Sequence Viewer
	QQJ42755	(Get FASTA)	NCBI Sequence Viewer
	QQJ42756	(Get FASTA)	NCBI Sequence Viewer
	QQJ42757	(Get FASTA)	NCBI Sequence Viewer
	QQJ42758	(Get FASTA)	NCBI Sequence Viewer
	QQJ42759	(Get FASTA)	NCBI Sequence Viewer
	QQJ42760	(Get FASTA)	NCBI Sequence Viewer
	QQJ42761	(Get FASTA)	NCBI Sequence Viewer
	QQJ42762	(Get FASTA)	NCBI Sequence Viewer
	QQJ42763	(Get FASTA)	NCBI Sequence Viewer
	QQJ42764	(Get FASTA)	NCBI Sequence Viewer
	QQJ42765	(Get FASTA)	NCBI Sequence Viewer
	QQJ42766	(Get FASTA)	NCBI Sequence Viewer
	QQJ42767	(Get FASTA)	NCBI Sequence Viewer
	QQJ42768	(Get FASTA)	NCBI Sequence Viewer
	QQJ42769	(Get FASTA)	NCBI Sequence Viewer
	QQJ42770	(Get FASTA)	NCBI Sequence Viewer
	QQJ42771	(Get FASTA)	NCBI Sequence Viewer
	QQJ42772	(Get FASTA)	NCBI Sequence Viewer
	QQJ42773	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_942064 ⟸ NM_198769
- Peptide Label:	precursor
- UniProtKB:	Q6YGU2 (UniProtKB/TrEMBL), A6J5V7 (UniProtKB/TrEMBL), E9PTD9 (UniProtKB/TrEMBL), A0A8K0ZGH5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLQALWLFWILMAVIGLSREGHSAQASLSCDAAGVCDGSSRSFTSIPSGLTANTKKLDLSFNKI TYIGHGDLRACVNLRVLTLESSGINTIEGDAFYSLGSLEHLDLSNNHLSSLSSSWFRPLSSLKY LNLMGNPYRTLGETSLFSNLTNLQTLRVGNVDTFSEIRRIDFAGLTSLNELEIQVLSLGNYESR SLQSIRDIYHLTLHLSESAFLLGIFADILSSVRYLELRDTNLARFQFSELSVDEINSPMKKLAF RNADLTDKSFNELLKLLRYILELMEVEFDHCTLNGVGNFNPSESDVVRELGKVETVTIRSLHIP QFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACEG GWPSLQSLVLSQNHLRSIRKTAEILLTLKNLTALDISKNSFQPMPDSCQWPGKMRFLNLSSTGI QAVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPEASLFPVLQVMKIRENAIS TFSKDQLGSFPKLETLEAGDNHFICSCELLSFILERPALVHVLVDWPDSYLCDSPPRLHGQRLQ DARPSVLECHQAALVSGVCCALLLLILLLGALCYHFHGLWYLRMMWAWLRAKRKPKKAPCRDLC YDAFVSYSEQDSYWVENLMVQQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLS ENFVRSEWCKYELDFSHFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPLDE GQREVFWANLRTAIKS hide sequence

RefSeq Acc Id:	XP_008759324 ⟸ XM_008761102
- Peptide Label:	isoform X1
- UniProtKB:	E9PTD9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLQALWLFWILMAVIGLSREGHSAQASLSCDAAGVCDGSSRSFTSIPSGLTANTKKLDLSFNKI TYIGHGDLRACVNLRVLTLESSGINTIEGDAFYSLGSLEHLDLSNNHLSSLSSSWFRPLSSLKY LNLMGNPYRTLGETSLFSNLTNLQNLRVGNVDTFSEIRRIDFAGLTSLNELEIQVLSLGNYESR SLQSIRDIYHLTLHLSESAFLLGIFADILSSVRYLELRDTNLARFQFSELSVDEINSPMKKLAF RNADLTDKSFNELLKLLRYILELMEVEFDHCTLNGVGNFNPSESDVVRELGKVETVTIRSLHIP QFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACEG GWPSLQSLVLSQNHLRSIRKTAEILLTLKNLTALDISKNSFQPMPDSCQWPGKMRFLNLSSTGI QAVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPEASLFPVLQVMKIRENAIS TFSKDQLGSFPKLETLEAGDNHFICSCELLSFILERPALVHVLVDWPDSYLCDSPPRLHGQRLQ DARPSVLECHQAALVSGVCCALLLLILLLGALCYHFHGLWYLRMMWAWLRAKRKPKKAPCRDLC YDAFVSYSEQDSYWVENLMVQQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLS ENFVRSEWCKYELDFSHFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPLDE GQREVFWANLRTAIKS hide sequence

RefSeq Acc Id:

ENSRNOP00000013025 ⟸ ENSRNOT00000013025

RefSeq Acc Id:

ENSRNOP00000095767 ⟸ ENSRNOT00000097289

Protein Domains

TIR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTD9-F1-model_v2	AlphaFold	E9PTD9	1-784	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735138	AgrOrtholog
BioCyc Gene	G2FUF-52648	BioCyc
Ensembl Genes	ENSRNOG00000009822	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000013025.3	UniProtKB/TrEMBL
	ENSRNOP00000095767	ENTREZGENE
	ENSRNOP00000095767.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013025.5	UniProtKB/TrEMBL
	ENSRNOT00000097289	ENTREZGENE
	ENSRNOT00000097289.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.10140	UniProtKB/TrEMBL
	3.80.10.10	UniProtKB/TrEMBL
InterPro	Cys-rich_flank_reg_C	UniProtKB/TrEMBL
	L_dom-like	UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/TrEMBL
	Leu-rich_rpt_typical-subtyp	UniProtKB/TrEMBL
	Toll-Interleukin_rcpt	UniProtKB/TrEMBL
	Toll-like_receptor	UniProtKB/TrEMBL
	Toll_tir_struct_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:310553	UniProtKB/TrEMBL
NCBI Gene	310553	ENTREZGENE
PANTHER	PTHR24365	UniProtKB/TrEMBL
	PTHR24365:SF17	UniProtKB/TrEMBL
Pfam	LRR_8	UniProtKB/TrEMBL
	TIR	UniProtKB/TrEMBL
PhenoGen	Tlr2	PhenoGen
PIRSF	Toll-like_receptor	UniProtKB/TrEMBL
PRINTS	INTRLKN1R1F	UniProtKB/TrEMBL
	LEURICHRPT	UniProtKB/TrEMBL
PROSITE	LRR	UniProtKB/TrEMBL
	TIR	UniProtKB/TrEMBL
SMART	LRR_BAC	UniProtKB/TrEMBL
	LRR_TYP	UniProtKB/TrEMBL
	LRRCT	UniProtKB/TrEMBL
	TIR	UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/TrEMBL
	RNI-like	UniProtKB/TrEMBL
	TIR	UniProtKB/TrEMBL
UniProt	A0A8K0ZGH5	ENTREZGENE, UniProtKB/TrEMBL
	A6J5V7	ENTREZGENE
	E9PTD9	ENTREZGENE, UniProtKB/TrEMBL
	Q6YGU2	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A6J5V7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Tlr2	toll-like receptor 2		toll-like receptor 2 variant 1	Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)