Advanced Search (OLGA)

Gene: Wnt4 (wingless-type MMTV integration site family, member 4) Mus musculus

Analyze

Symbol:

Wnt4

Name:

wingless-type MMTV integration site family, member 4

RGD ID:

733868

MGI Page

MGI

Description:

Enables frizzled binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of testosterone biosynthetic process; positive regulation of cellular component biogenesis; and regulation of DNA-templated transcription. Acts upstream of or within several processes, including epithelial cell differentiation; morphogenesis of an epithelium; and negative regulation of signal transduction. Located in cell surface; extracellular matrix; and extracellular space. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; heart; and sensory organ. Human ortholog(s) of this gene implicated in Mullerian aplasia and hyperandrogenism. Orthologous to human WNT4 (Wnt family member 4).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC123964; signal molecule; wingless-related MMTV integration site 4; Wnt-; Wnt-4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT4 (Wnt family member 4)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Wnt4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt4 (Wnt family member 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Wnt4 (Wnt family member 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	WNT4 (Wnt family member 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt4b (wingless-type MMTV integration site family, member 4b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	wnt4a (wingless-type MMTV integration site family, member 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	cwn-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Wnt2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wnt4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	137,004,946 - 137,026,812 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	137,004,800 - 137,027,037 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	137,277,635 - 137,299,501 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	137,277,489 - 137,299,726 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	136,833,550 - 136,852,694 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	136,549,711 - 136,568,855 (+)	NCBI		MGSCv36	mm8
Celera	4	135,495,983 - 135,515,320 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	69.8	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency (ISO)

46,XX Sex Reversal with Dysgenesis of Kidneys, Adrenals, and Lungs (ISO)

acute kidney failure (ISO)

congenital disorder of glycosylation Ir (ISO)

Dwarfism (ISO)

endometrial carcinoma (ISO)

Female Urogenital Diseases (ISO)

Fibroadenoma (ISO)

genetic disease (ISO)

hyperprolinemia type 2 (ISO)

kidney disease (ISO)

Mayer-Rokitansky-Kuster-Hauser syndrome (ISO)

Mullerian aplasia and hyperandrogenism (ISO)

ovarian carcinoma (ISO)

Parkinson's disease 6 (ISO)

Prostatic Neoplasms (ISO)

Urogenital Abnormalities (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(R)-adrenaline (EXP)

(S)-nicotine (EXP)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,3-dinitrobenzene (ISO)

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,4-dinitrotoluene (ISO)

2-nitrotoluene (ISO)

3,3',5-triiodo-L-thyronine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (EXP)

6-propyl-2-thiouracil (ISO)

8-Br-cAMP (ISO)

Abemaciclib (ISO)

acetamide (ISO)

acrylamide (ISO)

actinomycin D (ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (EXP,ISO)

allethrin (ISO)

alpha-Zearalanol (ISO)

ammonium chloride (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

Benzo[k]fluoranthene (EXP)

beryllium sulfate (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

bromobenzene (ISO)

bromochloroacetic acid (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium sulfate (ISO)

caffeine (ISO)

calciol (EXP)

camptothecin (ISO)

cantharidin (EXP)

chlordecone (EXP)

chlorpyrifos (EXP,ISO)

choline (EXP)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (EXP)

cyhalothrin (ISO)

cypermethrin (EXP,ISO)

D-glucose (ISO)

dexamethasone (ISO)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

dieldrin (ISO)

diethyl phthalate (EXP)

diethylstilbestrol (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (EXP)

Ethylenethiourea (EXP)

fenvalerate (ISO)

folic acid (EXP)

formaldehyde (ISO)

fulvestrant (EXP,ISO)

genistein (EXP)

gentamycin (ISO)

glucose (ISO)

hydroquinone (ISO)

indole-3-methanol (ISO)

indometacin (ISO)

L-methionine (EXP)

lead nitrate (EXP)

lead(0) (ISO)

lead(II) chloride (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

lithium atom (EXP)

lithium hydride (EXP)

mono(2-ethylhexyl) phthalate (EXP,ISO)

monobenzyl phthalate (EXP)

Monobutylphthalate (EXP)

monoethyl phthalate (EXP)

N-nitrosodiethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

N-Vinyl-2-pyrrolidone (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nicotine (EXP)

Nutlin-3 (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

organophosphorus compound (ISO)

oxybenzone (EXP)

paclitaxel (ISO)

panobinostat (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

picene (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP)

poly(I:C) (ISO)

progesterone (EXP,ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

simvastatin (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

Soman (ISO)

sotorasib (ISO)

tamoxifen (EXP)

tert-butyl hydroperoxide (EXP)

testosterone (EXP,ISO)

tetrachloromethane (EXP,ISO)

titanium dioxide (EXP)

trametinib (ISO)

trichostatin A (ISO)

triptonide (EXP)

valproic acid (EXP,ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adrenal gland development (IEA)

animal organ morphogenesis (IEA)

apoptotic signaling pathway (IGI)

branching involved in ureteric bud morphogenesis (IMP)

branching morphogenesis of an epithelial tube (IGI)

canonical Wnt signaling pathway (IBA,IDA,IEA,IGI,ISO,ISS)

cell differentiation (IMP)

cell fate commitment (IBA,IMP)

cell-cell signaling (TAS)

cellular response to estradiol stimulus (ISO)

cellular response to hydrostatic pressure (ISO)

cellular response to starvation (IEP)

cellular response to transforming growth factor beta stimulus (IEA)

embryonic epithelial tube formation (IDA)

epithelial to mesenchymal transition (IEA)

female gonad development (IMP)

female sex determination (IEA,ISO,ISS)

fibroblast growth factor receptor signaling pathway (IGI)

gamete generation (IGI)

hormone metabolic process (IMP)

immature T cell proliferation in thymus (IMP)

kidney development (IEA,ISO)

kidney morphogenesis (IGI)

liver development (IEA)

male gonad development (IEA,IMP,ISO,ISS)

mammary gland epithelium development (IEA,ISO)

meiotic nuclear division (IGI)

mesenchymal to epithelial transition (IMP)

mesonephric tubule development (IGI)

mesonephros development (IMP)

metanephric mesenchymal cell differentiation (NAS)

metanephric nephron development (IMP)

metanephric nephron morphogenesis (IMP)

metanephric tubule formation (IMP)

metanephros development (IMP,TAS)

negative regulation of androgen biosynthetic process (IEA,ISO,ISS)

negative regulation of apoptotic signaling pathway (IGI)

negative regulation of cell differentiation (IMP)

negative regulation of cell migration (IGI)

negative regulation of DNA-templated transcription (IDA,IEA,IMP,ISO,ISS)

negative regulation of fibroblast growth factor receptor signaling pathway (IGI)

negative regulation of gene expression (IEA,IMP,ISO,ISS)

negative regulation of male gonad development (IEA,ISO,ISS)

negative regulation of Ras protein signal transduction (IGI)

negative regulation of steroid biosynthetic process (IEA,ISO,ISS)

negative regulation of testicular blood vessel morphogenesis (IEA,ISO)

negative regulation of testosterone biosynthetic process (IEA,IMP,ISO)

negative regulation of wound healing (IGI)

nephron development (IMP)

neuron differentiation (IBA)

non-canonical Wnt signaling pathway (IDA,IEA,ISO)

oocyte development (IGI,IMP)

paramesonephric duct development (IEA,IMP,ISO,ISS)

pericyte cell differentiation (IDA,IMP)

positive regulation of aldosterone biosynthetic process (IEA,ISO,ISS)

positive regulation of bone mineralization (IEA,ISO,ISS)

positive regulation of collagen biosynthetic process (IEA,ISO,ISS)

positive regulation of cortisol biosynthetic process (IEA,ISO,ISS)

positive regulation of dermatome development (IEA,ISO,ISS)

positive regulation of DNA-templated transcription (IDA,IEA,IMP,ISO,ISS)

positive regulation of focal adhesion assembly (IGI)

positive regulation of MAPK cascade (IEA,ISO)

positive regulation of meiotic nuclear division (IGI)

positive regulation of osteoblast differentiation (IEA,ISO,ISS)

positive regulation of stress fiber assembly (IGI)

regulation of cell-cell adhesion (IMP)

renal vesicle formation (IMP)

renal vesicle induction (IDA)

response to benzoic acid (ISO)

response to estradiol (ISO)

response to retinoic acid (ISO)

Sertoli cell differentiation (IMP)

sex differentiation (IMP)

signal transduction (TAS)

smooth muscle cell differentiation (IDA,IMP)

somatotropin secreting cell differentiation (IMP)

T cell differentiation in thymus (IDA)

tertiary branching involved in mammary gland duct morphogenesis (IMP)

thyroid-stimulating hormone-secreting cell differentiation (IMP)

tube morphogenesis (IMP)

Wnt signaling pathway (IDA,IEA)

Cellular Component

cell surface (IDA)

cytoplasm (IEA,ISO,ISS)

endoplasmic reticulum lumen (TAS)

extracellular matrix (IDA)

extracellular region (IEA,TAS)

extracellular space (IBA,IDA,IEA,ISO,ISS)

Molecular Function

cytokine activity (IBA)

frizzled binding (IBA,IPI)

protein binding (IPI)

receptor ligand activity (IEA,ISO)

signaling receptor binding (IEA,TAS)

transcription corepressor activity (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,TAS)

Wnt signaling, canonical pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal adenohypophysis morphology (IAGP)

abnormal adrenal gland physiology (IAGP)

abnormal female germ cell morphology (IAGP)

abnormal kidney development (IAGP)

abnormal kidney mesenchyme morphology (IAGP)

abnormal kidney morphology (IAGP)

abnormal limb morphology (IAGP)

abnormal loop of Henle morphology (IAGP)

abnormal metanephric mesenchyme morphology (IAGP)

abnormal metanephros morphology (IAGP)

abnormal motor neuron morphology (IAGP)

abnormal nephrogenic mesenchyme morphogenesis (IAGP)

abnormal oogenesis (IAGP)

abnormal ovary development (IAGP)

abnormal ovary morphology (IAGP)

abnormal podocyte morphology (IAGP)

abnormal proximal convoluted tubule morphology (IAGP)

abnormal renal glomerulus morphology (IAGP)

abnormal renal tubule morphology (IAGP)

abnormal reproductive system development (IAGP)

abnormal secondary sex determination (IAGP)

absent kidney (IAGP)

absent Mullerian ducts (IAGP)

absent ovary capsule (IAGP)

atrioventricular cushion hypoplasia (IAGP)

decreased areal bone mineral density (IAGP)

decreased bone mineral density of femur (IAGP)

decreased bone trabecula number (IAGP)

decreased circulating cholesterol level (IEA)

decreased circulating HDL cholesterol level (IEA)

decreased femoral compact bone area (IAGP)

decreased gonadotroph cell number (IAGP)

decreased litter size (IAGP)

decreased lymphocyte cell number (IEA)

decreased mature ovarian follicle number (IAGP)

decreased motor neuron number (IAGP)

decreased oocyte number (IAGP)

decreased ovary weight (IAGP)

decreased renal glomerulus number (IAGP)

decreased somatotroph cell number (IAGP)

decreased thymocyte number (IAGP)

decreased thyrotroph cell number (IAGP)

decreased trabecular bone mass (IAGP)

delayed kidney development (IAGP)

disheveled coat (IAGP)

embryonic lethality, complete penetrance (IAGP)

hydronephrosis (IAGP)

increased circulating aspartate transaminase level (IEA)

increased circulating bilirubin level (IEA)

increased monocyte cell number (IEA)

increased neutrophil cell number (IEA)

kidney failure (IAGP)

lethality during fetal growth through weaning, incomplete penetrance (IAGP)

muscular ventricular septal defect (IAGP)

neonatal lethality, complete penetrance (IAGP)

no abnormal phenotype detected (IAGP)

oocyte degeneration (IAGP)

perimembraneous ventricular septal defect (IAGP)

postnatal growth retardation (IAGP)

postnatal lethality, complete penetrance (IAGP)

premature death (IAGP)

primary sex reversal (IAGP)

renal glomerulus cyst (IAGP)

secondary sex reversal (IAGP)

small kidney (IAGP)

small metanephros (IAGP)

thrombocytopenia (IEA)

ventricular septal defect (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	A WNT4 mutation associated with Mullerian-duct regression and virilization in a 46,XX woman.	Biason-Lauber A, etal., N Engl J Med. 2004 Aug 19;351(8):792-8.
2.	Expression and hormone regulation of Wnt2, 3, 4, 5a, 7a, 7b and 10b in normal human endometrium and endometrial carcinoma.	Bui TD, etal., Br J Cancer. 1997;75(8):1131-6.
3.	Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.	Huguet EL, etal., Cancer Res. 1994 May 15;54(10):2615-21.
4.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
5.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
6.	MGDs mouse GO annotations	MGD data from the GO Consortium
7.	MGD IEA	MGD IEA
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
14.	The evolutionarily conserved porcupine gene family is involved in the processing of the Wnt family.	Tanaka K, etal., Eur J Biochem 2000 Jul;267(13):4300-11.
15.	Expression and function of the developmental gene Wnt-4 during experimental acute renal failure in rats.	Terada Y, etal., J Am Soc Nephrol 2003 May;14(5):1223-33.
16.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.

Additional References at PubMed

PMID:1373817	PMID:1846319	PMID:2279700	PMID:7590254	PMID:7590255	PMID:7649383	PMID:7990960	PMID:8058323	PMID:8167409	PMID:8275860	PMID:8575294	PMID:8666231
PMID:8951078	PMID:9165114	PMID:9271117	PMID:9356179	PMID:9435283	PMID:9620855	PMID:9671592	PMID:9716459	PMID:9853965	PMID:9858722	PMID:9889131	PMID:9891778
PMID:9989404	PMID:10349636	PMID:10415363	PMID:10572052	PMID:10585256	PMID:10654605	PMID:10704890	PMID:10733525	PMID:11042159	PMID:11076861	PMID:11114168	PMID:11171333
PMID:11265645	PMID:11283799	PMID:11429295	PMID:11507767	PMID:11520664	PMID:11688560	PMID:11832423	PMID:11861511	PMID:11914369	PMID:11920562	PMID:11948913	PMID:11956231
PMID:12223418	PMID:12379851	PMID:12399432	PMID:12421715	PMID:12466851	PMID:12475749	PMID:12477932	PMID:12482961	PMID:12554773	PMID:12617826	PMID:12619136	PMID:12702652
PMID:12732619	PMID:12799076	PMID:12815618	PMID:12835383	PMID:12949260	PMID:14628042	PMID:14628051	PMID:14671310	PMID:14681479	PMID:14695376	PMID:15044261	PMID:15149334
PMID:15162500	PMID:15201225	PMID:15226823	PMID:15265686	PMID:15289436	PMID:15312687	PMID:15326356	PMID:15342465	PMID:15371327	PMID:15581876	PMID:15634693	PMID:15778975
PMID:15790596	PMID:15880404	PMID:15930111	PMID:15932923	PMID:15944199	PMID:15950605	PMID:15964998	PMID:16049111	PMID:16049112	PMID:16054034	PMID:16140269	PMID:16141072
PMID:16141073	PMID:16186384	PMID:16207837	PMID:16368682	PMID:16378759	PMID:16423875	PMID:16426441	PMID:16439479	PMID:16452457	PMID:16469829	PMID:16546160	PMID:16675530
PMID:16678101	PMID:16700629	PMID:16818445	PMID:16844427	PMID:17036046	PMID:17041600	PMID:17050676	PMID:17055474	PMID:17064353	PMID:17172448	PMID:17314325	PMID:17452023
PMID:17494089	PMID:17505543	PMID:17537789	PMID:17690294	PMID:17711857	PMID:17720811	PMID:17728319	PMID:17804636	PMID:17826763	PMID:17940049	PMID:17943183	PMID:17951031
PMID:17976036	PMID:17976063	PMID:18155190	PMID:18250097	PMID:18250098	PMID:18287559	PMID:18344980	PMID:18346943	PMID:18351662	PMID:18351675	PMID:18364260	PMID:18391535
PMID:18395837	PMID:18403409	PMID:18436715	PMID:18617424	PMID:18617533	PMID:18618131	PMID:18635608	PMID:18682239	PMID:18697834	PMID:18708054	PMID:18729207	PMID:18775421
PMID:18800919	PMID:18927154	PMID:18981061	PMID:18991257	PMID:19036799	PMID:19060336	PMID:19093031	PMID:19124014	PMID:19129494	PMID:19164599	PMID:19165927	PMID:19185060
PMID:19268447	PMID:19282366	PMID:19285468	PMID:19301398	PMID:19334288	PMID:19363157	PMID:19369396	PMID:19400999	PMID:19460349	PMID:19501082	PMID:19515997	PMID:19538736
PMID:19562671	PMID:19591821	PMID:19598129	PMID:19715689	PMID:19740593	PMID:19753101	PMID:19757380	PMID:19806668	PMID:19809516	PMID:19820125	PMID:19830824	PMID:19842175
PMID:19884258	PMID:19906864	PMID:19961844	PMID:19962424	PMID:20003319	PMID:20005806	PMID:20040496	PMID:20040500	PMID:20106871	PMID:20299358	PMID:20359476	PMID:20371632
PMID:20454446	PMID:20458143	PMID:20823064	PMID:20843830	PMID:20940229	PMID:20944551	PMID:21041481	PMID:21084449	PMID:21163860	PMID:21185284	PMID:21193738	PMID:21248078
PMID:21248711	PMID:21255566	PMID:21262216	PMID:21267068	PMID:21293032	PMID:21295565	PMID:21343368	PMID:21350016	PMID:21354128	PMID:21386911	PMID:21430080	PMID:21453014
PMID:21486947	PMID:21490063	PMID:21491542	PMID:21531785	PMID:21533152	PMID:21541287	PMID:21559298	PMID:21574244	PMID:21592645	PMID:21613322	PMID:21623369	PMID:21654186
PMID:21731673	PMID:21771967	PMID:21852398	PMID:21863216	PMID:21873635	PMID:21884692	PMID:21926402	PMID:21936019	PMID:21937690	PMID:21963425	PMID:22110055	PMID:22114204
PMID:22114682	PMID:22166339	PMID:22173065	PMID:22234613	PMID:22253774	PMID:22253844	PMID:22432025	PMID:22465478	PMID:22467513	PMID:22496664	PMID:22510988	PMID:22511595
PMID:22607657	PMID:22677559	PMID:22705479	PMID:22835934	PMID:22844512	PMID:22866057	PMID:22902740	PMID:22912798	PMID:22954793	PMID:22956684	PMID:22972715	PMID:22998873
PMID:23027131	PMID:23071697	PMID:23091613	PMID:23095882	PMID:23102580	PMID:23102581	PMID:23190887	PMID:23201013	PMID:23213461	PMID:23260145	PMID:23274689	PMID:23288785
PMID:23300479	PMID:23313125	PMID:23362348	PMID:23364326	PMID:23376422	PMID:23386589	PMID:23475960	PMID:23555292	PMID:23560082	PMID:23583383	PMID:23613466	PMID:23661808
PMID:23676498	PMID:23685333	PMID:23704941	PMID:23762375	PMID:23766539	PMID:23769843	PMID:23824573	PMID:23827310	PMID:23840809	PMID:23843232	PMID:23884445	PMID:23904126
PMID:23974041	PMID:23987514	PMID:24036309	PMID:24371124	PMID:24394376	PMID:24440154	PMID:24443808	PMID:24452333	PMID:24550112	PMID:24586192	PMID:24598167	PMID:24681597
PMID:24727668	PMID:24744442	PMID:24768153	PMID:24852369	PMID:24899573	PMID:24904088	PMID:24909139	PMID:24952961	PMID:24956260	PMID:24971735	PMID:24997521	PMID:25012664
PMID:25053437	PMID:25108526	PMID:25158167	PMID:25168025	PMID:25172430	PMID:25187620	PMID:25224227	PMID:25428587	PMID:25452386	PMID:25458011	PMID:25587709	PMID:25603931
PMID:25645944	PMID:25651362	PMID:25687138	PMID:25725066	PMID:25758227	PMID:25803581	PMID:25804736	PMID:25805134	PMID:25926361	PMID:26035382	PMID:26047795	PMID:26093309
PMID:26116176	PMID:26141512	PMID:26288816	PMID:26321050	PMID:26362256	PMID:26397044	PMID:26450967	PMID:26484393	PMID:26512061	PMID:26536904	PMID:26658320	PMID:26700598
PMID:26721931	PMID:26794322	PMID:26939755	PMID:27013242	PMID:27151977	PMID:27199373	PMID:27313319	PMID:27362799	PMID:27382987	PMID:27414999	PMID:27504979	PMID:27582005
PMID:27600466	PMID:27624192	PMID:28045957	PMID:28049832	PMID:28118982	PMID:28334964	PMID:28348167	PMID:28575050	PMID:28637242	PMID:28637295	PMID:28659595	PMID:28760814
PMID:28800889	PMID:28807898	PMID:28813421	PMID:28834739	PMID:28860115	PMID:28900034	PMID:28938467	PMID:28973166	PMID:29031500	PMID:29056552	PMID:29113990	PMID:29211850
PMID:29335243	PMID:29357412	PMID:29377931	PMID:29432158	PMID:29449451	PMID:29712641	PMID:29735715	PMID:29879378	PMID:29945868	PMID:30010727	PMID:30067986	PMID:30220568
PMID:30237523	PMID:30285093	PMID:30347193	PMID:30352686	PMID:30367465	PMID:30377232	PMID:30552336	PMID:30676318	PMID:30853690	PMID:30940800	PMID:31104943	PMID:31118232
PMID:31142573	PMID:31167144	PMID:31175162	PMID:31216173	PMID:31226309	PMID:31495781	PMID:31548351	PMID:31604927	PMID:31636514	PMID:31647919	PMID:31685872	PMID:31689386
PMID:31712577	PMID:31772170	PMID:31910233	PMID:31914354	PMID:31923383	PMID:31953387	PMID:32001436	PMID:32141129	PMID:32218432	PMID:32253237	PMID:32324134	PMID:32365547
PMID:32452519	PMID:32493750	PMID:32497039	PMID:32541007	PMID:32554463	PMID:32586976	PMID:32634398	PMID:32715478	PMID:32855415	PMID:32855417	PMID:32907846	PMID:33103447
PMID:33141892	PMID:33328171	PMID:33441379	PMID:33500353	PMID:33590845	PMID:33730615	PMID:33846290	PMID:33882146	PMID:34032268	PMID:34108685	PMID:34128985	PMID:34292881
PMID:34321664	PMID:34321999	PMID:34547456	PMID:34590686	PMID:34815802	PMID:34850745	PMID:35075134	PMID:35084365	PMID:35105870	PMID:35119382	PMID:35132078	PMID:35137408
PMID:35178390	PMID:35194044	PMID:35306493	PMID:35337816	PMID:35341793	PMID:35364055	PMID:35451473	PMID:35560108	PMID:35613264	PMID:35704566	PMID:35764169	PMID:35831952
PMID:35858415	PMID:35874829	PMID:35877077	PMID:35906245	PMID:36205075	PMID:36271049	PMID:36282544	PMID:36305473	PMID:36362374	PMID:36435829	PMID:36448532	PMID:36543770
PMID:36786658	PMID:36796745	PMID:36960826	PMID:37000005	PMID:37028407	PMID:37052590	PMID:37155872	PMID:37453535	PMID:37471646	PMID:37505110	PMID:37524711	PMID:37702066
PMID:37727504	PMID:37772431	PMID:37873566	PMID:38007516	PMID:38078651	PMID:38346980	PMID:38374140	PMID:38501211	PMID:38537630	PMID:38653356	PMID:38692273	PMID:39009564
PMID:39178848	PMID:39772668

Genomics

Comparative Map Data

Wnt4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	137,004,946 - 137,026,812 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	137,004,800 - 137,027,037 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	137,277,635 - 137,299,501 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	137,277,489 - 137,299,726 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	136,833,550 - 136,852,694 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	136,549,711 - 136,568,855 (+)	NCBI		MGSCv36	mm8
Celera	4	135,495,983 - 135,515,320 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	69.8	NCBI

WNT4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	22,117,313 - 22,143,097 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	22,117,313 - 22,143,969 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	22,443,806 - 22,469,590 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	22,316,385 - 22,342,106 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	22,191,504 - 22,214,916	NCBI
Celera	1	20,766,732 - 20,792,452 (-)	NCBI		Celera
Cytogenetic Map	1	p36.12	NCBI
HuRef	1	20,687,456 - 20,707,677 (-)	NCBI		HuRef
CHM1_1	1	22,556,295 - 22,576,527 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	21,941,071 - 21,966,860 (-)	NCBI		T2T-CHM13v2.0

Wnt4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	154,797,245 - 154,818,565 (+)	NCBI		GRCr8
GRCr8 Ensembl	5	154,797,311 - 154,817,128 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	5	149,513,573 - 149,535,415 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	149,514,018 - 149,532,859 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	152,211,413 - 152,230,231 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	153,985,716 - 154,004,530 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	153,967,711 - 153,986,525 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	155,649,238 - 155,668,065 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	155,649,217 - 155,672,579 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	159,405,855 - 159,424,682 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	156,064,371 - 156,083,198 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	147,911,190 - 147,930,012 (+)	NCBI		Celera
RGSC_v3.1	5	156,074,409 - 156,093,237 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

Wnt4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	2,319,446 - 2,344,989 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	2,319,446 - 2,344,740 (-)	NCBI	ChiLan1.0	ChiLan1.0

WNT4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	204,797,117 - 204,824,726 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	203,909,033 - 203,935,541 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	21,310,228 - 21,335,985 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	22,252,344 - 22,264,858 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	22,255,056 - 22,268,801 (-)	Ensembl	panpan1.1		panPan2

WNT4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	77,112,045 - 77,129,702 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	77,101,300 - 77,127,111 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	73,605,854 - 73,632,899 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	77,660,017 - 77,687,063 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	77,659,490 - 77,687,070 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	74,480,520 - 74,507,565 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	75,489,331 - 75,516,389 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	76,493,182 - 76,520,234 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	41,798,680 - 41,823,413 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	7,623,463 - 7,635,664 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	7,623,462 - 7,635,416 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	80,110,238 - 80,138,165 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	74,137,827 - 74,165,540 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	110,517,391 - 110,543,802 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	110,517,564 - 110,541,203 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	5,754,333 - 5,781,060 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	6,921,811 - 6,933,392 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	6,913,027 - 6,934,650 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt4
1123 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	1311
Count of miRNA genes:	603
Interacting mature miRNAs:	758
Transcripts:	ENSMUST00000045747
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301267	Bcmd2_m	B cell maturation defect 2 (mouse)			Not determined		4	133154678	150789451	Mouse
4142139	Adip12_m	adiposity 12 (mouse)			Not determined		4	124621281	156860686	Mouse
10047132	Albq19_m	albuminuria QTL 19 (mouse)			Not determined		4	112824389	146824389	Mouse
1301525	Lmb1_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		4	124264957	150676858	Mouse
14746982	Manh56_m	mandible shape 56 (mouse)					4	117815917	151815917	Mouse
4141623	W6q13_m	weight 6 weeks QTL 13 (mouse)			Not determined			88982069	140468203	Mouse
12910797	Pwgrq4_m	pre-weaning growth rate QTL 4 (mouse)					4	105835310	141433838	Mouse
25314312	Syncl2_m	synaptonemal complex length 2 (mouse)					4	65718237	146584457	Mouse
12910794	Pwbwq8_m	post-weaning body weight QTL 8 (mouse)					4	105835310	141433838	Mouse
1300743	Skull6_m	skull morphology 6 (mouse)			Not determined		4	111009051	145009280	Mouse
1301382	Arvm2_m	autoimmune renal vasculitis 2 (mouse)			Not determined		4	107791564	141791756	Mouse
1302149	Tlsr2_m	thymic lymphoma suppressor region 2 (mouse)			Not determined		4	124264957	142230960	Mouse
12910813	Pwbwq4_m	pre-weaning body weight QTL 4 (mouse)					4	105835310	141433838	Mouse
1300874	Gasa2_m	gastritis type A susceptibility locus 2 (mouse)			Not determined		4	133010494	156860686	Mouse
4141093	W3q17_m	weight 3 weeks QTL 17 (mouse)			Not determined			88982069	140468203	Mouse
27226757	Femd1_m	femur midshaft diameter 1, 5 week (mouse)					4	123993793	144326570	Mouse
12050091	Shm2_m	sperm head morphology 2 (mouse)					4	136876000	138342753	Mouse
12910808	Pwbwq9_m	post-weaning body weight QTL 9 (mouse)					4	105835310	141433838	Mouse
1300621	Tpnr1_m	thermal pain response 1 (mouse)			Not determined		4	125230872	156860686	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
4142493	Femwf13_m	femur work to failure 13 (mouse)			Not determined			116154678	150154782	Mouse
1301815	Sles2_m	systemic lupus erythmatosus suppressor 2 (mouse)			Not determined		4	94957579	150676858	Mouse
1300663	Start2_m	startle response 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1300917	Gasa1_m	gastritis type A susceptibility locus 1 (mouse)			Not determined		4	124055093	142438020	Mouse
1300537	Ap3q_m	alcohol preference 3 QTL (mouse)			Not determined		4	134654451	156860686	Mouse
1301823	Bmd7_m	bone mineral density 7 (mouse)			Not determined		4	88982069	151654550	Mouse
10412210	Cypr6_m	cytokine production 6 (mouse)			Not determined		4	120617848	154617995	Mouse
1302078	Sluc21_m	susceptibility to lung cancer 21 (mouse)			Not determined		4	117401141	151401275	Mouse
10045620	Heal22_m	wound healing/regeneration 22 (mouse)			Not determined		4	125230872	156860686	Mouse
4142481	Gct1_m	granulosa cell tumorigenesis 1 (mouse)			Not determined		4	127784226	156860686	Mouse
4141065	Shali2_m	survival time to hyperoxic acute lung injury 2 (mouse)			Not determined			124055093	141572792	Mouse
13503348	Bntq18_m	bone traits QTL 18 (mouse)					4	120617848	154617995	Mouse
13208562	Wght7_m	weight 7 (mouse)					4	90888237	148084457	Mouse
4142082	Psds2_m	psoriasis-like skin disease severity 2 (mouse)			Not determined		4	133154678	137617995	Mouse
1300781	Lith8_m	lithogenic gene 8 (mouse)			Not determined		4	107264957	141265153	Mouse
39128212	Lwq21_m	liver weight QTL 21 (mouse)					4	88982069	140468203	Mouse
4142077	Ignpq2_m	IgA nephropathy QTL 2 (mouse)			Not determined		4	133676733	156860686	Mouse
4141180	Ssic1_m	susceptibility to small intestinal cancer 1 (mouse)			Not determined			120674005	154674151	Mouse
1301584	Lrdg2_m	light induced retinal degeneration 2 (mouse)			Not determined		4	129465811	151654550	Mouse
1302102	Bis1_m	beta-carboline-induced seizures 1 (mouse)			Not determined		4	119864433	153864536	Mouse
10043996	Gct5_m	granulosa cell tumorigenesis 5 (mouse)			Not determined		4	127784226	156860686	Mouse
26884445	Sklq7_m	skull length QTL 7, 10 week (mouse)					4	68018237	150884457	Mouse
10043985	Stheal12_m	soft tissue heal 12 (mouse)			Not determined		4	121342649	155342753	Mouse
1301982	Pltiq1_m	phospholipid transfer protein inducibility QTL 1 (mouse)			Not determined		4	124621281	156860686	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
1300803	Sluc6_m	susceptibility to lung cancer 6 (mouse)			Not determined		4	120674005	154674151	Mouse
4141549	W10q10_m	weight 10 weeks QTL 10 (mouse)			Not determined			88982069	140468203	Mouse
4142061	Chlq16_m	circulating hormone level QTL 16 (mouse)			Not determined		4	121342649	155342753	Mouse
1357895	Ctrcts_m	cataract severity (mouse)			Not determined		4	45709925	138342753	Mouse
1300933	Cdcs9_m	cytokine deficiency colitis susceptibility 9 (mouse)			Not determined		4	125230872	156860686	Mouse
1300809	Ccrs2_m	corpus callosum hemisphere surface size 2 (mouse)			Not determined		4	107264957	141265153	Mouse
4141154	Nba1_m	New Zealand Black autoimmunity 1 (mouse)			Not determined			131650724	140879275	Mouse
1301964	Bw8q2_m	body weight at 8 weeks QTL 2 (mouse)			Not determined		4	119864433	153864536	Mouse
1301452	Elsgp1_m	elevated serum gp70 1 (mouse)			Not determined		4	121342649	155342753	Mouse
10755520	Rbc1_m	red blood cell count 1 (mouse)					4	108477692	142477692	Mouse
10755521	Hct1_m	hematocrit 1 (mouse)					4	108477692	142477692	Mouse
10755522	Hgb1_m	hemoglobin 1 (mouse)					4	108477692	142477692	Mouse
1301108	Scon2_m	sucrose consumption 2 (mouse)			Not determined		4	134654451	156860686	Mouse
1300858	Tafat_m	tally ho associated mesenteric fat pad weight (mouse)			Not determined		4	124621281	156860686	Mouse
4141779	Ssrq8_m	stress response QTL 8 (mouse)			Not determined			136876000	137617995	Mouse
10755531	Lymph3_m	lymphocyte differential 3 (mouse)					4	124553483	156860686	Mouse
15039382	Ltgq7_m	liver triglyceride QTL 7 (mouse)					4	105705794	139705794	Mouse
11533916	Mts1_m	mammary tumor susceptibility 1 (mouse)					4	125289325	156860686	Mouse
15039377	Bw45_m	body weight QTL 45 (mouse)					4	105705794	139705794	Mouse
1300839	Dyscalc2_m	dystrophic cardiac calcinosis 2 (mouse)			Not determined		4	111009051	145009280	Mouse
4141001	Tgq17_m	triglyceride QTL 17 (mouse)			Not determined			112523489	146523489	Mouse
15039378	Adip30_m	adiposity 30 (mouse)					4	105705794	139705794	Mouse
1357800	Tgq3_m	triglyceride QTL 3 (mouse)			Not determined		4	107055093	141055180	Mouse
15039385	Mvlq3_m	macrovesicular liver lesion QTL 3 (mouse)					4	112182386	146182386	Mouse

Markers in Region

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
MGSCv37	4	136,851,439 - 136,851,709	UniSTS	GRCm37
MGSCv37	4	136,851,442 - 136,851,605	UniSTS	GRCm37
Celera	4	135,514,068 - 135,514,231	UniSTS
Celera	4	135,514,065 - 135,514,335	UniSTS
Cytogenetic Map	4	D3	UniSTS
cM Map	4		UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	137,295,527 - 137,295,690	UniSTS	GRCm38
MGSCv37	4	136,851,442 - 136,851,605	UniSTS	GRCm37
Celera	4	135,514,068 - 135,514,231	UniSTS
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	137,295,524 - 137,295,794	UniSTS	GRCm38
MGSCv37	4	136,851,439 - 136,851,709	UniSTS	GRCm37
Celera	4	135,514,065 - 135,514,335	UniSTS
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS

Wnt4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	D3	UniSTS
cM Map	4		UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF414100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK012727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK135561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL645468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CQ970152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M89797	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000045747 ⟹ ENSMUSP00000036580

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	137,004,800 - 137,027,037 (+)	Ensembl
GRCm38.p6 Ensembl	4	137,277,489 - 137,299,726 (+)	Ensembl

RefSeq Acc Id:

NM_009523 ⟹ NP_033549

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	137,004,946 - 137,026,812 (+)	NCBI
GRCm38	4	137,277,635 - 137,299,501 (+)	ENTREZGENE
MGSCv37	4	136,833,550 - 136,852,694 (+)	RGD
Celera	4	135,495,983 - 135,518,012 (+)	ENTREZGENE
cM Map	4		ENTREZGENE

Sequence:

show sequence

CGGGAGCCTTGCGGCCGCTGCCCCGGGCTGGGCGCGCACGGCACCATGAGCCCCCGTTCGTGCC
TGCGGTCCCTGCGACTCCTCGTCTTCGCCGTGTTCTCGGCCGCCGCGAGCAATTGGCTGTACCT
GGCCAAGCTGTCATCGGTGGGCAGCATCTCCGAAGAGGAGACGTGCGAGAAACTCAAAGGCCTG
ATCCAGAGGCAGGTGCAGATGTGCAAACGGAACCTTGAGGTGATGGACTCAGTGCGCCGTGGTG
CCCAGCTGGCCATCGAGGAGTGCCAATACCAGTTCCGGAACCGGCGCTGGAACTGTTCCACACT
GGACTCCCTCCCTGTCTTTGGGAAGGTGGTGACACAAGGGACCCGGGAGGCGGCCTTTGTATAC
GCCATCTCTTCAGCAGGTGTGGCCTTTGCAGTGACAAGGGCATGCAGCAGTGGAGAACTGGAGA
AGTGTGGCTGTGACCGGACAGTGCACGGGGTCAGCCCACAGGGCTTCCAGTGGTCAGGATGCTC
GGACAACATCGCCTATGGCGTAGCCTTCTCACAGTCCTTTGTGGACGTCCGGGAGAGGAGCAAG
GGGGCCTCCTCCAGCCGGGCACTCATGAATCTTCACAACAACGAGGCTGGCAGGAAGGCCATCT
TGACACACATGCGGGTGGAGTGCAAGTGTCACGGGGTGTCGGGCTCCTGCGAGGTAAAGACGTG
CTGGCGTGCTGTACCGCCCTTCCGCCAGGTTGGCCACGCGCTAAAGGAGAAGTTTGACGGTGCC
ACGGAGGTGGAGCCACGACGCGTAGGCTCCTCCCGGGCGCTGGTGCCTCGGAATGCACAGTTCA
AGCCACATACAGATGAGGACCTGGTATACCTGGAGCCTAGCCCGGACTTCTGTGAGCAGGACAT
CCGCAGTGGCGTGCTAGGCACGAGGGGCCGCACGTGCAACAAGACATCTAAAGCCATTGACGGC
TGCGAGCTACTGTGCTGTGGCCGCGGCTTCCACACAGCGCAAGTGGAGCTGGCCGAGCGCTGTG
GCTGCAGGTTCCACTGGTGCTGCTTCGTCAAGTGCCGGCAGTGCCAGCGGCTCGTGGAGATGCA
CACGTGCCGGTGACCATGCCGTCTGTGCCCAGGACCACCTGCGTGGCCCAGGGAAGGCCAATAA
CTTAAACAGTCTCCCACCACCTACCCCAAAAGATACTGGTTGTATTTTTTGTTTTGGTTTGGTT
TTTGGGTCCTCAAGTTATTTATTGCCAAAAAAAAAAAAAAAGAAAGAAAGAAAGAAAGAAAGAA
AGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAA
AAAAATAGGCAGGCAACCCCCAAGGGCACCAACCAGGGCCTCCCCGAGCCTGAGCCTTTGTGTG
TGGCTGCCTCTGACCAAAGGGACTTTGTTTATGCCTCTGGCTGTCCACATTGACCACTGTTGAC
TACTCAGTCTTGTCAAGTGTCCAGTTTTCTACAGGTAGACTAAAAAAGTAGGTACTAAGGAGCG
GCTGTAGACCCCACCGTCCAGGGAAACAGATGGCCCAATGGCAGGGATGGCAGGTTCCATCTTG
GTGGAATTTATATCACCTGCAGGAAAGGAGCTGACACCTCTCCACCACACATATACTTGGGGAC
CGCCAGTAACTCTGGCTCTGAGGGTCCCTAGAAAGGGAACGGACAGATATCAGGTTAAAGGCTA
AGGGCTCTCGGCCCTCATGCGAGCAGCTAGATTCCAGGCAAGCAACCGTGAGTTAAGACAAGGA
TGCCCAGCCAGGCGTGGTGGTGCATGCCTTTAATCCCAGCACTCAGGAGGCAGAGGCAGGTGGA
TTTCTGAGTTCGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGACTATACAGAG
AAACCCTGTCTCGAAAAACCAAAAAAAAAAAAAAAAAAAAAAAAAAGACAAGGATGTCCACGTG
AGGCCAGCCCACCTCCACCTCAAACTCCTCCATGAGAGGGGAAACCTCCCCTATTCCCAGACTC
TCCTAGGCAGGGTTAGGCTGTCATCCTGGATTAGGTCCTAGCTTGGGCCTGGCAAGTCGCACAC
CCGCCCCCTGTTATGAGTCACCCTCGCAGTTTTGTCCTCTGTGAAGCTGAGAATGGAAATGTTG
CAGAGACAGGAAAGGGCTGTGCAAAGAGATCCCACCCTGTGATATCTCCCTCACTTAACAAAAC
CTAGTGAGCAAACACAATGCCCCATCAGCCCCTGTCCTAGGGTATCTCCCTGGATGATGACATC
TGTCCTGGGAACAAACATGGATGCCCACCCACTCTTTGCAGCAGGTAATGATGCCTGTCAGCCT
CACAAGACCTTGGCAGAGGCAGAGCCGGGCTCCTCCCTGGGCCTGAGCAGTGGGCTAGGAACTC
TGGCTATAACTAAAGGCACAGGGAGACAAGGCAGTAGGAGCCAGAGACCACAGGCTGGGTTGGA
GCCCACAGGGCTGCAAAGGGCTAAGAGGCTGAGTGGAGAGGGGGACAGCTGGAGGGCTGACTAA
TTAGGTCTCAGAATCCAAGGTACCTCCATCTCCAGGACCCTGGGTCCCCAAGGCCTCGAGTACA
GTAAGGACAAAAGGTTCCCCAAGGGACATACCATACCTGGTGCCTGGCCCAGAACACCAGCCAG
ACTGTCAAGAACCTACCAAATGCTCTGTGAACAGGACACACAAAGAATCAACTGCCTCTCGGCT
GGATGACCAAGCCTCAGAGGAACTTTCCAGCCTGATGTCCAAGTGGCTCCCATGTCCAGGACTC
CAGGTTCGATGCTTCCACTCTGAGATCCCCTTGGGAACTCTGCAATCCCAAGCTCTTTGCTATT
GGGTGGTGCAAACGCCAAATCCAGGATTCTGAATACGGGGCGCAGGCCTGCACAAACTCTCCTC
TGGGCCTGTGGTTTGTGCCTTTCTGGCGTTGGCTCCCTGACGAAGAGGGTCAACACCCTTGGCC
CCCATCCAAGCTCTCTGCTCATTGTCCATCTGAAGAGGCAGCCAAAACCAAGTGAGATGCTGGA
ACCACATTCAAATGCAAGGATAATCTTGGGCAGGCCGTCTCTGATGTGGATGAAAGCTGAGCTG
ACCAAGGGTCCCCACAGCTGCCCGGCTGGGCCCACTGATCCTCTGGTAGACTTAGTTCAGCACC
AGGGAAGATGTGAGGACCCCACACACACACACACATACACAGAGCCAGGCCCAAACTAAGGAAG
CATGGGGCCACCCCTTCAGAGAATGCTGAGCCAAGTTCCACATCCAGTGGGGTCGAGACTGCTT
GTCATTTTGTGGACACTATACCAAGAAGGCGGGTCCCTAGCTCCCCTGTGCTGATCCTCTCAGA
GTCCTGCAGGCTGTGACTAGGTGAATCAGACCACAGGCTAGAACCACTGCCCAGGCCAAAGAAA
TTCACAGCCATGGTGGGGGACGTGGGAGGGGGGGGGGGAGCTTCACTGGACTTGTCCAGCTCCA
AACTGTCTCAAATATAAAGAGCTGGCAAAGGCGTGACGTAGCTCAGCATATTTGGGTCCCACAG
GACCCAGGAAGCTGTCCAGAAGGTCCACTTCCTACCTGAACCACTCTCTACTGTTGTTGTCACA
AGGCAAAAGTGGCATTCCTTCCTCCAAGGCCAGGGCTGGAAAAGCCAGCTCCGGATGCTGCTAC
TCTACCGTGCTGCCCCACCCCGTCCTCCAGTTTTTATATGAGGCTCCTTGGCATTGTGACATCC
CCACGGCATAGTCTGAGATGCACGATAAAAATGGTTATTTCTCTATC

hide sequence

Protein Sequences


Protein RefSeqs	NP_033549	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40566	(Get FASTA)	NCBI Sequence Viewer
	AAI01963	(Get FASTA)	NCBI Sequence Viewer
	AAI03561	(Get FASTA)	NCBI Sequence Viewer
	AAI03562	(Get FASTA)	NCBI Sequence Viewer
	AAI03563	(Get FASTA)	NCBI Sequence Viewer
	AAL10394	(Get FASTA)	NCBI Sequence Viewer
	BAE22582	(Get FASTA)	NCBI Sequence Viewer
	CAI38663	(Get FASTA)	NCBI Sequence Viewer
	EDL29922	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000036580
	ENSMUSP00000036580.5
GenBank Protein	P22724	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_033549 ⟸ NM_009523
- Peptide Label:	precursor
- UniProtKB:	P22724 (UniProtKB/Swiss-Prot), Q3ZB23 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVM DSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRAC SSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE AGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALV PRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQV ELAERCGCRFHWCCFVKCRQCQRLVEMHTCR hide sequence

Ensembl Acc Id:

ENSMUSP00000036580 ⟸ ENSMUST00000045747

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P22724-F1-model_v2	AlphaFold	P22724	1-351	view protein structure

Promoters

RGD ID:

6836668

Promoter ID:

MM_KWN:40243

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day1

Transcripts:

OTTMUST00000022760

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	4	136,833,266 - 136,833,766 (+)	MPROMDB

RGD ID:

6885142

Promoter ID:

EPDNEW_M6022

Type:

multiple initiation site

Name:

Wnt4_1

Description:

Mus musculus wingless-type MMTV integration site family, member4 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	4	137,277,589 - 137,277,649	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:98957	AgrOrtholog
Ensembl Genes	ENSMUSG00000036856	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000045747	ENTREZGENE
	ENSMUST00000045747.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.2460.20	UniProtKB/Swiss-Prot
InterPro	Wnt	UniProtKB/Swiss-Prot
	Wnt4	UniProtKB/Swiss-Prot
	Wnt_C	UniProtKB/Swiss-Prot
	Wnt_CS	UniProtKB/Swiss-Prot
KEGG Report	mmu:22417	UniProtKB/Swiss-Prot
MGD	MGI:98957	ENTREZGENE
NCBI Gene	22417	ENTREZGENE
PANTHER	PROTEIN WNT-4	UniProtKB/Swiss-Prot
	PTHR12027	UniProtKB/Swiss-Prot
Pfam	wnt	UniProtKB/Swiss-Prot
PhenoGen	Wnt4	PhenoGen
PRINTS	WNT4PROTEIN	UniProtKB/Swiss-Prot
	WNTPROTEIN	UniProtKB/Swiss-Prot
PROSITE	WNT1	UniProtKB/Swiss-Prot
SMART	WNT1	UniProtKB/Swiss-Prot
UniProt	P22724	ENTREZGENE
	Q3ZB23	ENTREZGENE, UniProtKB/TrEMBL
	WNT4_MOUSE	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-01	Wnt4	wingless-type MMTV integration site family, member 4		wingless-related MMTV integration site 4	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Mammalian Phenotype