Sftpc (surfactant associated protein C)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sftpc (surfactant associated protein C) Mus musculus

Analyze

Symbol:

Sftpc

Name:

surfactant associated protein C

RGD ID:

733829

MGI Page

MGI

Description:

Predicted to enable identical protein binding activity. Located in cytoplasm and extracellular region. Is expressed in several structures, including lung and main bronchus epithelium. Used to study desquamative interstitial pneumonia. Human ortholog(s) of this gene implicated in asthma; lung disease (multiple); and respiratory syncytial virus infectious disease. Orthologous to human SFTPC (surfactant protein C).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Bric; Bricd6; pr; pro-SpC; pulmonary surfactant-associated protein C; pulmonary surfactant-associated proteolipid SPL(Val); S; Sft; Sftp; Sftp-2; Sftp2; SP; SP-C; SP5; SPC

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SFTPC (surfactant protein C)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Sftpc (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sftpc (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SFTPC (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SFTPC (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sftpc (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SFTPC (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SFTPC (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sftpc (surfactant protein C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Sftpc (surfactant protein C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SFTPC (surfactant protein C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	70,758,381 - 70,761,521 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	70,758,389 - 70,761,521 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	70,520,941 - 70,524,081 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	70,520,949 - 70,524,081 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	70,920,748 - 70,923,888 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	69,256,020 - 69,259,150 (-)	NCBI		MGSCv36	mm8
Celera	14	68,062,491 - 68,065,631 (-)	NCBI		Celera
Cytogenetic Map	14	D2	NCBI
cM Map	14	36.32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult respiratory distress syndrome (ISO)

asthma (IEP,ISO)

bacterial pneumonia (IMP,ISO)

Bronchial Hyperreactivity (IEP)

chronic obstructive pulmonary disease (ISO)

cryptococcosis (IEP)

cystic fibrosis (ISO)

desquamative interstitial pneumonia (IAGP)

Diaphragmatic Hernia (ISO)

genetic disease (IEP,ISO)

Hyaline Membrane Disease (ISO)

Hyperoxia (ISO)

idiopathic pulmonary fibrosis (ISO)

interstitial lung disease (IMP,ISO)

lung adenocarcinoma (ISO)

lung disease (IGI,ISO)

myopathy (ISO)

newborn respiratory distress syndrome (ISO)

osteogenesis imperfecta (ISO)

osteogenesis imperfecta type 13 (ISO)

pneumocystosis (IEP)

pneumonia (IEP)

polycystic ovary syndrome (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (IMP,ISO)

Pulmonary Surfactant Metabolism Dysfunction 1 (ISO)

Pulmonary Surfactant Metabolism Dysfunction 2 (ISO)

Reperfusion Injury (ISO)

respiratory syncytial virus infectious disease (IMP,ISO)

Surfactant Dysfunction (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,7-dihydropurine-6-thione (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-phenylbutyric acid (ISO)

6-propyl-2-thiouracil (ISO)

8-Br-cAMP (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (EXP,ISO)

all-trans-retinol (ISO)

amiodarone (EXP)

ammonium chloride (ISO)

ATP (EXP,ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

bleomycin A2 (ISO)

bosentan (ISO)

carbon nanotube (EXP)

CHIR 99021 (ISO)

chlorpyrifos (EXP)

ciguatoxin CTX1B (EXP)

colforsin daropate hydrochloride (ISO)

cortisol (ISO)

crocidolite asbestos (EXP)

dexamethasone (ISO)

fonofos (ISO)

ionomycin (EXP,ISO)

L-ascorbic acid (ISO)

lead diacetate (EXP)

lipopolysaccharide (EXP,ISO)

LY294002 (EXP)

mercaptopurine (ISO)

N-ethyl-5'-carboxamidoadenosine (EXP,ISO)

nickel atom (EXP)

nickel subsulfide (ISO)

nickel sulfate (EXP)

nicotine (EXP)

nitric oxide (ISO)

nitrofen (EXP,ISO)

ozone (EXP,ISO)

paraquat (ISO)

parathion (ISO)

phorbol 13-acetate 12-myristate (EXP,ISO)

protein kinase inhibitor (ISO)

purine-6-thiol (ISO)

pyrrolidine dithiocarbamate (ISO)

resveratrol (ISO)

Ro 31-8220 (ISO)

S-nitroso-N-acetyl-D-penicillamine (ISO)

silicon carbide (ISO)

silicon dioxide (ISO)

sodium chlorate (ISO)

terbufos (ISO)

terbutaline (EXP,ISO)

testosterone (ISO)

titanium dioxide (EXP)

tubocurarine (EXP)

UTP (EXP)

valproic acid (EXP,ISO)

vinclozolin (ISO)

vinyl carbamate (EXP)

vitamin D (EXP)

wortmannin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to mechanical stimulus (ISO)

cellular response to nitric oxide (ISO)

circadian rhythm (ISO)

response to cAMP (ISO)

response to glucocorticoid (ISO)

response to glucose (ISO)

response to growth factor (ISO)

response to hormone (ISO)

response to hyperoxia (ISO)

response to interleukin-6 (ISO)

response to lipopolysaccharide (ISO)

response to organic substance (ISO)

response to retinoic acid (ISO)

response to vitamin A (ISO)

Cellular Component

alveolar lamellar body (IBA,ISO)

cytoplasm (IDA)

extracellular region (IDA)

extracellular space (IBA,ISO)

multivesicular body (ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal bronchus epithelium morphology (IAGP)

abnormal lung hysteresivity (IAGP)

abnormal lung interstitium morphology (IAGP)

abnormal lung morphology (IAGP)

abnormal lung vasculature morphology (IAGP)

abnormal pulmonary alveolus epithelial cell morphology (IAGP)

abnormal pulmonary alveolus morphology (IAGP)

abnormal pulmonary elastic fiber morphology (IAGP)

abnormal pulmonary interalveolar septum morphology (IAGP)

abnormal surfactant physiology (IAGP)

conjunctivitis (IAGP)

early reproductive senescence (IAGP)

emphysema (IAGP)

increased adenocarcinoma incidence (IAGP)

increased airway resistance (IAGP)

increased alveolar lamellar body number (IAGP)

increased lung adenocarcinoma incidence (IAGP)

increased lung adenoma incidence (IAGP)

increased type II pneumocyte number (IAGP)

overexpanded pulmonary alveolus (IAGP)

poor grooming (IAGP)

premature death (IAGP)

weight loss (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Surfactant protein deficiency in familial interstitial lung disease.	Amin RS, etal., J Pediatr. 2001 Jul;139(1):85-92.
2.	Pneumocystis carinii pneumonia alters expression and distribution of lung collectins SP-A and SP-D.	Atochina EN, etal., J Lab Clin Med. 2001 Jun;137(6):429-39.
3.	Attenuated allergic airway hyperresponsiveness in C57BL/6 mice is associated with enhanced surfactant protein (SP)-D production following allergic sensitization.	Atochina EN, etal., Respir Res. 2003 Dec 8;4:15. Print 2003.
4.	Two novel mutations in surfactant protein-C, lung function and obstructive lung disease.	Baekvad-Hansen M, etal., Respir Med. 2010 Mar;104(3):418-25. Epub 2009 Nov 11.
5.	A common mutation in the surfactant protein C gene associated with lung disease.	Cameron HS, etal., J Pediatr. 2005 Mar;146(3):370-5.
6.	Surfactant protein levels in bronchoalveolar lavage after segmental allergen challenge in patients with asthma.	Erpenbeck VJ, etal., Allergy. 2006 May;61(5):598-604.
7.	Dynamic investigation of alveolar type II cell function in a long-term survival model of rat lung ischemia-reperfusion injury.	Feng D, etal., Scand J Clin Lab Invest. 2010 Sep;70(5):364-73.
8.	Serum surfactant protein D is increased in acute and chronic inflammation in mice.	Fujita M, etal., Cytokine. 2005 Jul 7;31(1):25-33.
9.	Surfactant protein C-deficient mice are susceptible to respiratory syncytial virus infection.	Glasser SW, etal., Am J Physiol Lung Cell Mol Physiol. 2009 Jul;297(1):L64-72. Epub 2009 Mar 20.
10.	Pneumonitis and emphysema in sp-C gene targeted mice.	Glasser SW, etal., J Biol Chem. 2003 Apr 18;278(16):14291-8. Epub 2003 Jan 7.
11.	Macrophage dysfunction and susceptibility to pulmonary Pseudomonas aeruginosa infection in surfactant protein C-deficient mice.	Glasser SW, etal., J Immunol. 2008 Jul 1;181(1):621-8.
12.	Pulmonary surfactant, lung function, and endobronchial inflammation in cystic fibrosis.	Griese M, etal., Am J Respir Crit Care Med. 2004 Nov 1;170(9):1000-5. Epub 2004 Jul 21.
13.	New surfactant protein C gene mutations associated with diffuse lung disease.	Guillot L, etal., J Med Genet. 2009 Jul;46(7):490-4. Epub 2009 May 13.
14.	Defective surfactant secretion in a mouse model of Hermansky-Pudlak syndrome.	Guttentag SH, etal., Am J Respir Cell Mol Biol. 2005 Jul;33(1):14-21. Epub 2005 Mar 24.
15.	Aspergillus fumigatus-induced allergic airway inflammation alters surfactant homeostasis and lung function in BALB/c mice.	Haczku A, etal., Am J Respir Cell Mol Biol. 2001 Jul;25(1):45-50.
16.	Effects of rSP-C surfactant on oxygenation and histology in a rat-lung-lavage model of acute lung injury.	Hafner D, etal., Am J Respir Crit Care Med. 1998 Jul;158(1):270-8.
17.	Comparison of rSP-C surfactant with natural and synthetic surfactants after late treatment in a rat model of the acute respiratory distress syndrome.	Hafner D, etal., Br J Pharmacol. 1998 Jul;124(6):1083-90.
18.	Lung epithelium is the major source of IL-33 and is regulated by IL-33-dependent and IL-33-independent mechanisms in pulmonary cryptococcosis.	Heyen L, etal., Pathog Dis. 2016 Oct;74(7). pii: ftw086. doi: 10.1093/femspd/ftw086. Epub 2016 Sep 4.
19.	Deficiency of SP-B reveals protective role of SP-C during oxygen lung injury.	Ikegami M, etal., J Appl Physiol. 2002 Feb;92(2):519-26.
20.	Increased and prolonged pulmonary fibrosis in surfactant protein C-deficient mice following intratracheal bleomycin.	Lawson WE, etal., Am J Pathol. 2005 Nov;167(5):1267-77.
21.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
22.	MGDs mouse GO annotations	MGD data from the GO Consortium
23.	MGD IEA	MGD IEA
24.	A mutation in the surfactant protein C gene associated with familial interstitial lung disease.	Nogee LM, etal., N Engl J Med. 2001 Feb 22;344(8):573-9.
25.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
26.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
27.	Haplotypes of surfactant protein C are associated with common paediatric lung diseases.	Puthothu B, etal., Pediatr Allergy Immunol. 2006 Dec;17(8):572-7.
28.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
29.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
30.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
31.	Total extracellular surfactant is increased but abnormal in a rat model of gram-negative bacterial pneumonia.	Russo TA, etal., Am J Physiol Lung Cell Mol Physiol. 2002 Sep;283(3):L655-63.
32.	Respiratory distress after intratracheal bleomycin: selective deficiency of surfactant proteins B and C.	Savani RC, etal., Am J Physiol Lung Cell Mol Physiol. 2001 Sep;281(3):L685-96.
33.	Time-dependent changes in pulmonary surfactant function and composition in acute respiratory distress syndrome due to pneumonia or aspiration.	Schmidt R, etal., Respir Res. 2007 Jul 27;8:55.
34.	Clinical features and genetic analysis of surfactant protein C in adult-onset familial interstitial pneumonia.	Setoguchi Y, etal., Respirology. 2006 Jan;11 Suppl:S41-5.
35.	[Genetic basis in chronic interstitial familial pneumopathy. Familial study of SFTPC]	Somaschini M, etal., Pediatr Med Chir. 2005 May-Aug;27(3-4):103-7.
36.	Overexpression of surfactant protein SP-A, SP-B, and SP-C mRNA in rat lungs with lipopolysaccharide-induced injury.	Sugahara K, etal., Lab Invest. 1996 Jan;74(1):209-20.
37.	[Polymorphic variants of a surfactant protein C gene in patients with chronic obstructive pulmonary disease].	Tsvetkova OA and Veselovskaia MV, Ter Arkh. 2007;79(9):65-9.
38.	SFTPC Mutations are the Basis of a Significant Portion of Adult Familial Pulmonary Fibrosis in a Dutch Cohort.	van Moorsel CH, etal., Am J Respir Crit Care Med. 2010 Jul 23.
39.	Aberrant processing of surfactant protein C in hereditary SP-B deficiency.	Vorbroker DK, etal., Am J Physiol. 1995 Apr;268(4 Pt 1):L647-56.
40.	Elevated expression of surfactant proteins in newborn rats during adaptation to hyperoxia.	White CW, etal., Am J Respir Cell Mol Biol. 2001 Jul;25(1):51-9.

Additional References at PubMed

PMID:1346779	PMID:1733280	PMID:2254341	PMID:7543410	PMID:7628695	PMID:7644495	PMID:7913017	PMID:8001981	PMID:8622914	PMID:8674409	PMID:8813084	PMID:9006067
PMID:9056643	PMID:9441679	PMID:9486531	PMID:9768363	PMID:9922208	PMID:9925645	PMID:10208743	PMID:10409672	PMID:10457010	PMID:10479457	PMID:10572052	PMID:10600892
PMID:10675334	PMID:10696067	PMID:10744075	PMID:10749753	PMID:10749754	PMID:11002344	PMID:11171334	PMID:11254358	PMID:11287183	PMID:11344267	PMID:11429286	PMID:11437453
PMID:11458389	PMID:11493531	PMID:11493558	PMID:11748835	PMID:11751207	PMID:11850179	PMID:11959831	PMID:12015298	PMID:12024028	PMID:12034570	PMID:12112468	PMID:12142021
PMID:12361974	PMID:12477932	PMID:12495930	PMID:12496149	PMID:12761850	PMID:12812790	PMID:12819125	PMID:12829717	PMID:12885771	PMID:12941618	PMID:14517255	PMID:14525980
PMID:14645514	PMID:14645847	PMID:14970209	PMID:15005800	PMID:15016731	PMID:15042703	PMID:15105378	PMID:15117747	PMID:15162506	PMID:15162513	PMID:15169678	PMID:15186480
PMID:15336546	PMID:15452354	PMID:15531758	PMID:15572153	PMID:15580568	PMID:15591414	PMID:15623520	PMID:15632069	PMID:15668254	PMID:15677768	PMID:15695173	PMID:15716345
PMID:15778712	PMID:15844178	PMID:15907834	PMID:16033766	PMID:16141072	PMID:16157679	PMID:16166744	PMID:16214823	PMID:16236725	PMID:16337335	PMID:16399789	PMID:16414041
PMID:16427040	PMID:16534186	PMID:16574095	PMID:16574109	PMID:16630564	PMID:16691571	PMID:16698852	PMID:16864775	PMID:17000766	PMID:17035289	PMID:17069789	PMID:17119023
PMID:17121831	PMID:17164424	PMID:17220277	PMID:17383628	PMID:17394208	PMID:17428829	PMID:17438133	PMID:17464327	PMID:17560563	PMID:17583691	PMID:17765889	PMID:17849452
PMID:18023262	PMID:18069687	PMID:18097062	PMID:18161062	PMID:18186922	PMID:18196599	PMID:18213577	PMID:18239190	PMID:18256198	PMID:18258849	PMID:18321928	PMID:18324732
PMID:18342301	PMID:18356571	PMID:18358466	PMID:18367557	PMID:18374910	PMID:18483625	PMID:18536717	PMID:18543320	PMID:18544451	PMID:18599506	PMID:18651661	PMID:18990706
PMID:19008920	PMID:19097117	PMID:19112494	PMID:19233133	PMID:19299468	PMID:19369400	PMID:19391114	PMID:19412431	PMID:19423771	PMID:19465597	PMID:19498055	PMID:19502490
PMID:19574421	PMID:19574443	PMID:19631635	PMID:19686689	PMID:19710174	PMID:19786540	PMID:19805361	PMID:19835856	PMID:19850947	PMID:19855016	PMID:19897741	PMID:20048339
PMID:20060823	PMID:20147383	PMID:20223754	PMID:20228843	PMID:20303366	PMID:20407208	PMID:20530543	PMID:20553735	PMID:20595636	PMID:20727874	PMID:20852037	PMID:21049041
PMID:21129374	PMID:21169555	PMID:21257925	PMID:21267068	PMID:21270055	PMID:21303850	PMID:21350014	PMID:21385574	PMID:21408140	PMID:21438071	PMID:21482757	PMID:21503901
PMID:21505443	PMID:21513708	PMID:21515253	PMID:21659474	PMID:21682884	PMID:21701069	PMID:21704616	PMID:21791528	PMID:21826198	PMID:21865055	PMID:21873635	PMID:21896782
PMID:21985298	PMID:22001906	PMID:22014525	PMID:22096492	PMID:22096573	PMID:22123957	PMID:22162244	PMID:22194995	PMID:22331706	PMID:22411169	PMID:22411819	PMID:22421361
PMID:22493501	PMID:22675208	PMID:22730381	PMID:22821687	PMID:22876201	PMID:22878413	PMID:22916088	PMID:22917924	PMID:23023706	PMID:23028652	PMID:23063659	PMID:23139760
PMID:23195221	PMID:23204392	PMID:23285300	PMID:23293024	PMID:23341776	PMID:23399055	PMID:23405202	PMID:23408915	PMID:23449471	PMID:23466739	PMID:23523683	PMID:23526992
PMID:23590306	PMID:23620511	PMID:23637629	PMID:23637738	PMID:23696835	PMID:23701443	PMID:23742148	PMID:23795648	PMID:23836893	PMID:23884445	PMID:23895934	PMID:23921127
PMID:23922714	PMID:23924632	PMID:23980576	PMID:24058167	PMID:24164893	PMID:24191021	PMID:24274029	PMID:24275123	PMID:24282586	PMID:24391734	PMID:24499815	PMID:24591256
PMID:24661562	PMID:24733830	PMID:24785085	PMID:24843139	PMID:24860998	PMID:24886827	PMID:24939938	PMID:25035421	PMID:25043473	PMID:25079229	PMID:25091723	PMID:25100655
PMID:25114215	PMID:25166724	PMID:25180700	PMID:25220458	PMID:25358791	PMID:25395457	PMID:25480985	PMID:25516972	PMID:25533958	PMID:25723738	PMID:25790853	PMID:25865356
PMID:25912685	PMID:25978641	PMID:26001956	PMID:26146081	PMID:26178733	PMID:26235626	PMID:26252542	PMID:26329601	PMID:26402555	PMID:26416771	PMID:26439735	PMID:26488883
PMID:26511927	PMID:26555052	PMID:26567140	PMID:26743624	PMID:26816051	PMID:26878215	PMID:26921474	PMID:26984772	PMID:27035511	PMID:27106761	PMID:27141870	PMID:27150575
PMID:27190064	PMID:27312374	PMID:27335464	PMID:27341756	PMID:27355685	PMID:27364009	PMID:27412481	PMID:27481995	PMID:27498861	PMID:27578791	PMID:27645581	PMID:27654891
PMID:27694932	PMID:27699234	PMID:27748998	PMID:27770432	PMID:27861515	PMID:27864284	PMID:27880906	PMID:27913639	PMID:27967234	PMID:27979858	PMID:28002412	PMID:28216153
PMID:28228256	PMID:28237967	PMID:28273432	PMID:28314106	PMID:28323616	PMID:28346423	PMID:28351980	PMID:28380258	PMID:28385810	PMID:28431248	PMID:28501476	PMID:28501478
PMID:28506464	PMID:28515280	PMID:28546511	PMID:28618253	PMID:28619823	PMID:28653505	PMID:28675425	PMID:28722352	PMID:28737769	PMID:28746823	PMID:28811219	PMID:28827401
PMID:28838957	PMID:28839101	PMID:28855398	PMID:28859094	PMID:28886382	PMID:28886383	PMID:28923684	PMID:29079808	PMID:29083321	PMID:29176597	PMID:29251627	PMID:29345196
PMID:29400695	PMID:29420258	PMID:29436664	PMID:29489752	PMID:29516783	PMID:29587142	PMID:29587145	PMID:29672221	PMID:29752282	PMID:29853539	PMID:29920187	PMID:29950483
PMID:29999500	PMID:30022023	PMID:30183330	PMID:30194919	PMID:30305289	PMID:30389913	PMID:30389914	PMID:30578393	PMID:30604742	PMID:30643263	PMID:30651296	PMID:30655340
PMID:30721158	PMID:30728831	PMID:30778223	PMID:30782824	PMID:30865885	PMID:30887098	PMID:30910861	PMID:30944105	PMID:30985294	PMID:30996081	PMID:31028085	PMID:31028279
PMID:31056475	PMID:31067462	PMID:31135379	PMID:31180191	PMID:31199666	PMID:31240265	PMID:31242446	PMID:31242448	PMID:31287803	PMID:31358769	PMID:31432712	PMID:31455666
PMID:31462798	PMID:31467330	PMID:31486675	PMID:31548395	PMID:31562139	PMID:31582725	PMID:31685810	PMID:31738079	PMID:31767619	PMID:31771978	PMID:31776260	PMID:31792060
PMID:31813798	PMID:31934347	PMID:32001436	PMID:32046118	PMID:32059772	PMID:32059792	PMID:32067289	PMID:32127497	PMID:32208105	PMID:32317081	PMID:32324833	PMID:32394892
PMID:32491951	PMID:32579851	PMID:32661339	PMID:32682987	PMID:32750316	PMID:32841604	PMID:32989251	PMID:33039355	PMID:33057196	PMID:33057360	PMID:33216742	PMID:33219378
PMID:33254076	PMID:33296658	PMID:33428297	PMID:33687752	PMID:33707239	PMID:33830085	PMID:33863742	PMID:33947861	PMID:33951416	PMID:33968067	PMID:33972447	PMID:33974915
PMID:33979629	PMID:33998997	PMID:34079126	PMID:34138759	PMID:34230964	PMID:34237032	PMID:34431978	PMID:34497269	PMID:34626771	PMID:34671097	PMID:34789718	PMID:34793600
PMID:34927678	PMID:34931663	PMID:34932949	PMID:35050901	PMID:35303432	PMID:35351885	PMID:35512705	PMID:35676931	PMID:35682694	PMID:35705813	PMID:35765931	PMID:35803279
PMID:36098964	PMID:36115458	PMID:36414616	PMID:36433959

Genomics

Comparative Map Data

Sftpc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	70,758,381 - 70,761,521 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	70,758,389 - 70,761,521 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	70,520,941 - 70,524,081 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	70,520,949 - 70,524,081 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	70,920,748 - 70,923,888 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	69,256,020 - 69,259,150 (-)	NCBI		MGSCv36	mm8
Celera	14	68,062,491 - 68,065,631 (-)	NCBI		Celera
Cytogenetic Map	14	D2	NCBI
cM Map	14	36.32	NCBI

SFTPC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	22,157,383 - 22,164,479 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	8	22,156,913 - 22,164,479 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	22,014,896 - 22,021,992 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	22,075,129 - 22,077,937 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	22,075,112 - 22,077,928	NCBI
Celera	8	20,981,168 - 20,983,976 (+)	NCBI		Celera
Cytogenetic Map	8	p21.3	NCBI
HuRef	8	20,561,488 - 20,564,296 (+)	NCBI		HuRef
CHM1_1	8	22,220,843 - 22,223,651 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	22,431,328 - 22,438,424 (+)	NCBI		T2T-CHM13v2.0

Sftpc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	15	45,596,565 - 45,599,615 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	45,596,574 - 45,610,777 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	49,714,437 - 49,717,379 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	15	50,825,943 - 50,828,885 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	15	47,685,234 - 47,688,176 (-)	NCBI	Rnor_WKY
Rnor_6.0	15	52,211,538 - 52,214,480 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	52,211,544 - 52,214,616 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	55,935,055 - 55,937,997 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	50,923,105 - 50,926,047 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	50,938,884 - 50,941,827 (-)	NCBI
Celera	15	45,274,971 - 45,277,913 (-)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

Sftpc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	45,649,122 - 45,651,837 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	45,649,149 - 45,651,421 (+)	NCBI	ChiLan1.0	ChiLan1.0

SFTPC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	8	18,343,007 - 18,348,764 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	18,345,940 - 18,348,764 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	8	21,402,060 - 21,409,438 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SFTPC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	35,088,295 - 35,090,995 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	35,088,279 - 35,091,457 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	35,677,864 - 35,680,614 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	35,299,616 - 35,302,366 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	35,299,694 - 35,302,250 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	35,245,093 - 35,247,843 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	35,099,613 - 35,102,363 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	35,255,134 - 35,257,884 (-)	NCBI		UU_Cfam_GSD_1.0

Sftpc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	12,588,481 - 12,596,579 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936555	5,979,417 - 5,982,011 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936555	5,966,610 - 5,982,083 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SFTPC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	6,440,309 - 6,443,095 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	6,440,309 - 6,443,104 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	6,868,096 - 6,880,564 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SFTPC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	20,229,756 - 20,233,568 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	20,230,870 - 20,234,020 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	22,002,517 - 22,009,591 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sftpc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	17,742,415 - 17,744,655 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	17,742,439 - 17,744,664 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	168
Count of miRNA genes:	145
Interacting mature miRNAs:	161
Transcripts:	ENSMUST00000022692
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357589	Kdnw2_m	kidney weight 2 (mouse)			Not determined		14	20887473	121269804	Mouse
1357527	Epfpq1_m	epididymal fat percentage QTL 1 (mouse)			Not determined		14	21062450	71885801	Mouse
27226774	Tibl15_m	tibia length 15, 10 week (mouse)					14	30321957	87937436	Mouse
10043887	Cia50_m	collagen induced arthritis QTL 50 (mouse)			Not determined		14	37430185	71430320	Mouse
4142419	Tgq26_m	triglyceride QTL 26 (mouse)			Not determined			40337319	74337319	Mouse
1301777	Bglq15_m	body growth late QTL 15 (mouse)			Not determined		14	42962416	76962593	Mouse
1301424	Skull21_m	skull morphology 21 (mouse)			Not determined		14	42962416	76962593	Mouse
1300805	Mors3_m	modifier of obesity related sterility 3 (mouse)			Not determined		14	43037270	77037418	Mouse
1301091	Bbaa21_m	B.burgdorferi-associated arthritis 21 (mouse)			Not determined		14	43065847	77066045	Mouse
4141400	Nilac8_m	nicotine induced locomotor activity 8 (mouse)			Not determined		14	43065847	77066045	Mouse
1300605	El5_m	epilepsy 5 (mouse)			Not determined		14	49455425	83455556	Mouse
4142364	Pbwg18_m	postnatal body weight growth 18 (mouse)			Not determined		14	52281984	86282125	Mouse
1301489	Lbm10_m	lean body mass 10 (mouse)			Not determined		14	53761296	87761529	Mouse
12880432	Fgf23lq3_m	FGF23 serum level QTL 3 (mouse)					14	53937440	87937440	Mouse
10043889	Cia52_m	collagen induced arthritis QTL 52 (mouse)			Not determined		14	56082381	90082509	Mouse
1301562	Hwq1_m	heart weight quantitative locus 1 (mouse)			Not determined		14	56546745	90546941	Mouse
1357565	wrmod1_m	wobbler modifier 1 (mouse)			Not determined		14	58179640	101859473	Mouse
11039527	Ccc2_m	colitis susceptibility in the Collaborative Cross 2 (mouse)					14	59918612	94138217	Mouse
1300666	Fembm2_m	femoral bone morphometry 2 (mouse)			Not determined		14	62397460	96397680	Mouse
14747006	Mancz12_m	mandible centroid size 12 (mouse)					14	70071977	104071977	Mouse

Markers in Region

D14Mit33

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	14	70,523,236 - 70,523,528	UniSTS	GRCm38
MGSCv37	14	70,923,043 - 70,923,335	UniSTS	GRCm37
Celera	14	68,064,786 - 68,065,078	UniSTS
Cytogenetic Map	14	D2	UniSTS
cM Map	14	32.5	UniSTS
Whitehead Genetic	14	40.4	UniSTS
Whitehead_YAC	14		UniSTS

D14Mit32

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	14	70,523,856 - 70,524,089	UniSTS	GRCm38
MGSCv37	14	70,923,663 - 70,923,896	UniSTS	GRCm37
Celera	14	68,065,406 - 68,065,639	UniSTS
Cytogenetic Map	14	D2	UniSTS
cM Map	14	32.5	UniSTS
Whitehead Genetic	14	40.4	UniSTS
Whitehead_YAC	14		UniSTS

Sftpc

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	14	70,521,402 - 70,522,178	UniSTS	GRCm38
MGSCv37	14	70,921,209 - 70,921,985	UniSTS	GRCm37
Celera	14	68,062,952 - 68,063,728	UniSTS
Cytogenetic Map	14	D2	UniSTS
cM Map	14	32.5	UniSTS
cM Map	14	32.5	UniSTS

Sftpc

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	14	70,522,232 - 70,522,679	UniSTS	GRCm38
MGSCv37	14	70,922,039 - 70,922,486	UniSTS	GRCm37
Celera	14	68,063,782 - 68,064,229	UniSTS
Cytogenetic Map	14	D2	UniSTS

Sftpc

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	14	70,521,432 - 70,522,703	UniSTS	GRCm38
MGSCv37	14	70,921,239 - 70,922,510	UniSTS	GRCm37
Celera	14	68,062,982 - 68,064,253	UniSTS
Cytogenetic Map	14	D2	UniSTS
cM Map	14	32.5	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_011359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY773034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CJ093163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CJ237354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M38314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000022692 ⟹ ENSMUSP00000022692

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	14	70,758,393 - 70,761,521 (-)	Ensembl
GRCm38.p6 Ensembl	14	70,520,953 - 70,524,081 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000227152

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	14	70,758,389 - 70,759,616 (-)	Ensembl
GRCm38.p6 Ensembl	14	70,520,949 - 70,522,176 (-)	Ensembl

RefSeq Acc Id:

NM_011359 ⟹ NP_035489

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	14	70,758,381 - 70,761,521 (-)	NCBI
GRCm38	14	70,520,941 - 70,524,081 (-)	ENTREZGENE
MGSCv37	14	70,920,748 - 70,923,888 (-)	RGD
Celera	14	68,062,491 - 68,065,631 (-)	RGD
cM Map	14		ENTREZGENE

Sequence:

show sequence

GAGATGAGGAGAGGAGAGAGAGAGAGAAACCTTACAAAATGGACATGAGTAGCAAAGAGGTCCT
GATGGAGAGTCCACCGGATTACTCGGCAGGTCCCAGGAGCCAGTTCCGCATCCCCTGCTGTCCC
GTGCACCTCAAACGCCTTCTCATCGTGGTTGTGGTGGTGGTCCTCGTTGTCGTGGTGATTGTAG
GGGCTCTGCTCATGGGCCTCCACATGAGTCAAAAACATACTGAGATGGTCCTTGAGATGAGCAT
CGGAGCACCGGAAACTCAGAAACGCCTAGCCCCGAGTGAGCGAGCAGACACCATCGCTACCTTT
TCCATCGGCTCCACTGGCATCGTTGTGTATGACTACCAGCGGCTCCTGACGGCCTATAAGCCAG
CTCCAGGAACCTACTGCTACATCATGAAGATGGCTCCAGAGAGCATCCCTAGTCTTGAGGCTTT
CGCTAGAAAACTCCAGAACTTCCAGGCCAAGCCCTCCACACCCACCTCTAAGCTGGGCCAGGAG
GAAGGGCATGATACTGGTTCCGAGTCCGATTCTTCCGGGAGAGACCTGGCTTTCCTAGGCCTTG
CTGTGAGCACCCTGTGTGGAGAGCTACCACTCTACTATATCTAGCATCCACAGGGTCGGTAGAA
ACCGCAGCGGGACAGGAAAGACCCTCCGCAAAGGGTCTTTGTCAGACAAGCAGGAAGCTGCTCC
TGCCCAGAAACCGGTGGAAGTCTGTAAAGGAAAGGTGTCTCTCCTACGGGCCAGGGGGATCCTA
TCACAAAAGAATAAAGCAGCCTGATTGGAAAACAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_035489	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40010	(Get FASTA)	NCBI Sequence Viewer
	AAH61137	(Get FASTA)	NCBI Sequence Viewer
	EDL35896	(Get FASTA)	NCBI Sequence Viewer
	P21841	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_035489 ⟸ NM_011359
- UniProtKB:	Q6P8P8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKH TEMVLEMSIGAPETQKRLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTYCYIMKMAP ESIPSLEAFARKLQNFQAKPSTPTSKLGQEEGHDTGSESDSSGRDLAFLGLAVSTLCGELPLYY I hide sequence

RefSeq Acc Id:

ENSMUSP00000022692 ⟸ ENSMUST00000022692

Protein Domains

BRICHOS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21841-F1-model_v2	AlphaFold	P21841	1-193	view protein structure

Promoters

RGD ID:

8682920

Promoter ID:

EPDNEW_M19491

Type:

multiple initiation site

Name:

Sftpc_1

Description:

Mus musculus surfactant associated protein C , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	14	70,524,076 - 70,524,136	EPDNEW

RGD ID:

6847139

Promoter ID:

MM_ACW:16518

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Lung

Transcripts:

SFTPC.BSEP07

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	14	70,921,621 - 70,922,672 (-)	MPROMDB

RGD ID:

6825409

Promoter ID:

MM_KWN:17386

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Lung

Transcripts:

NM_011359_SFTPC

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	14	70,923,371 - 70,923,871 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:109517	AgrOrtholog
Ensembl Genes	ENSMUSG00000022097	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000022692	ENTREZGENE
	ENSMUSP00000022692.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000022692	ENTREZGENE
	ENSMUST00000022692.5	UniProtKB/TrEMBL
InterPro	BRICHOS_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SP-C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SP-C_palmitoylation_site	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Surfactant_protein_propep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:20389	UniProtKB/TrEMBL
MGD	MGI:109517	ENTREZGENE
NCBI Gene	20389	ENTREZGENE
PANTHER	PTHR10800	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	BRICHOS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SP_C-Propep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sftpc	PhenoGen
PROSITE	BRICHOS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SURFACT_PALMITOYL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	BRICHOS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SF_P	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	P21841	ENTREZGENE, UniProtKB/Swiss-Prot
	Q6P8P8	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Mammalian Phenotype