Advanced Search (OLGA)

Gene: Zwint (ZW10 interactor) Mus musculus

Analyze

Symbol:

Zwint

Name:

ZW10 interactor

RGD ID:

733387

MGI Page

MGI

Description:

Involved in homologous chromosome orientation in meiotic metaphase I and regulation of meiosis I spindle assembly checkpoint. Located in kinetochore. Is expressed in several structures, including early conceptus; heart valve; nervous system; oocyte; and retina. Orthologous to human ZWINT (ZW10 interacting kinetochore protein).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2010007E07Rik; 2600001N01Rik; D10Ertd749; D10Ertd749e; outer kinetochore KNL1 complex subunit ZWINT; ZW10-interacting protein 1; Zwint-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Gm6332 Gm6575 Gm8099

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	72,490,678 - 72,510,796 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	72,490,677 - 72,510,796 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	72,654,846 - 72,674,964 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	72,654,845 - 72,674,964 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	72,117,643 - 72,132,537 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	72,050,213 - 72,070,263 (+)	NCBI		MGSCv36	mm8
Celera	10	73,721,825 - 73,736,719 (+)	NCBI		Celera
Cytogenetic Map	10	B5.3	NCBI
cM Map	10	37.15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	COVID-19		ISO	RGD:1347195	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	hepatocellular carcinoma		ISO	RGD:1347195	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28284560

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	(+)-schisandrin B	multiple interactions	ISO	RGD:628671	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ZWINT mRNA]	CTD	PMID:31150632
Zwint	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ZWINT mRNA	CTD	PMID:36331819
Zwint	Mouse	1,1-dichloroethene	increases expression	EXP		6480464	vinylidene chloride results in increased expression of ZWINT mRNA	CTD	PMID:26682919
Zwint	Mouse	1,2-dimethylhydrazine	affects expression	EXP		6480464	1,2-Dimethylhydrazine affects the expression of ZWINT mRNA	CTD	PMID:22206623
Zwint	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZWINT mRNA	CTD	PMID:22206623
Zwint	Mouse	17beta-estradiol	increases expression	ISO	RGD:1347195	6480464	Estradiol results in increased expression of ZWINT mRNA	CTD	PMID:16474171\|PMID:19167446\|PMID:19698761
Zwint	Mouse	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of ZWINT mRNA	CTD	PMID:39298647
Zwint	Mouse	2,2',4,4',5,5'-hexachlorobiphenyl	increases expression	EXP		6480464	2,4,5,2',4',5'-hexachlorobiphenyl results in increased expression of ZWINT mRNA	CTD	PMID:20005886
Zwint	Mouse	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of ZWINT mRNA	CTD	PMID:30294300
Zwint	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of ZWINT mRNA	CTD	PMID:19465110
Zwint	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:628671	6480464	Tetrachlorodibenzodioxin results in decreased expression of ZWINT mRNA	CTD	PMID:33387578
Zwint	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1347195	6480464	Tetrachlorodibenzodioxin affects the expression of ZWINT mRNA	CTD	PMID:22574217
Zwint	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1347195	6480464	Tetrachlorodibenzodioxin results in decreased expression of ZWINT mRNA	CTD	PMID:21802500
Zwint	Mouse	2,3-dimethoxynaphthalene-1,4-dione	increases expression	ISO	RGD:1347195	6480464	2,3-dimethoxy-1,4-naphthoquinone results in increased expression of ZWINT mRNA	CTD	PMID:17547211\|PMID:19031421
Zwint	Mouse	2,4-dinitrotoluene	affects expression	ISO	RGD:628671	6480464	2,4-dinitrotoluene affects the expression of ZWINT mRNA	CTD	PMID:21346803
Zwint	Mouse	2,6-dinitrotoluene	affects expression	ISO	RGD:628671	6480464	2,6-dinitrotoluene affects the expression of ZWINT mRNA	CTD	PMID:21346803
Zwint	Mouse	2-butoxyethanol	increases expression	EXP		6480464	n-butoxyethanol results in increased expression of ZWINT mRNA	CTD	PMID:19812364
Zwint	Mouse	3,3',5,5'-tetrabromobisphenol A	increases expression	ISO	RGD:628671	6480464	tetrabromobisphenol A results in increased expression of ZWINT mRNA	CTD	PMID:27914987
Zwint	Mouse	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1347195	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Zwint	Mouse	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1347195	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Zwint	Mouse	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:628671	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Zwint	Mouse	4,4'-sulfonyldiphenol	affects expression	EXP		6480464	bisphenol S affects the expression of ZWINT mRNA	CTD	PMID:39298647
Zwint	Mouse	4-amino-2,6-dinitrotoluene	affects expression	ISO	RGD:628671	6480464	4-amino-2,6-dinitrotoluene affects the expression of ZWINT mRNA	CTD	PMID:21346803
Zwint	Mouse	5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole	affects expression	ISO	RGD:628671	6480464	Omeprazole affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	6-propyl-2-thiouracil	affects expression	ISO	RGD:628671	6480464	Propylthiouracil affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	6-propyl-2-thiouracil	increases expression	ISO	RGD:628671	6480464	Propylthiouracil results in increased expression of ZWINT mRNA	CTD	PMID:36843608
Zwint	Mouse	acetamide	increases expression	ISO	RGD:628671	6480464	acetamide results in increased expression of ZWINT mRNA	CTD	PMID:31881176
Zwint	Mouse	acrylamide	decreases expression	ISO	RGD:1347195	6480464	Acrylamide results in decreased expression of ZWINT mRNA	CTD	PMID:32763439
Zwint	Mouse	afimoxifene	decreases expression	ISO	RGD:1347195	6480464	afimoxifene results in decreased expression of ZWINT mRNA	CTD	PMID:19698761
Zwint	Mouse	aflatoxin B1	affects expression	ISO	RGD:1347195	6480464	Aflatoxin B1 affects the expression of ZWINT protein	CTD	PMID:20106945
Zwint	Mouse	aflatoxin B1	decreases expression	ISO	RGD:628671	6480464	Aflatoxin B1 results in decreased expression of ZWINT mRNA	CTD	PMID:33354967
Zwint	Mouse	aflatoxin B1	decreases methylation	ISO	RGD:1347195	6480464	Aflatoxin B1 results in decreased methylation of ZWINT gene	CTD	PMID:27153756
Zwint	Mouse	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of ZWINT mRNA	CTD	PMID:19770486
Zwint	Mouse	aldehydo-D-glucose	multiple interactions	ISO	RGD:628671	6480464	ZWINT protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency]	CTD	PMID:21124846
Zwint	Mouse	all-trans-retinoic acid	decreases expression	ISO	RGD:1347195	6480464	Tretinoin results in decreased expression of ZWINT mRNA	CTD	PMID:33167477
Zwint	Mouse	amiodarone	affects expression	ISO	RGD:628671	6480464	Amiodarone affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	ammonium chloride	affects expression	ISO	RGD:628671	6480464	Ammonium Chloride affects the expression of ZWINT mRNA	CTD	PMID:16483693
Zwint	Mouse	antimony(0)	increases expression	ISO	RGD:1347195	6480464	Antimony results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	aristolochic acid A	increases expression	ISO	RGD:1347195	6480464	aristolochic acid I results in increased expression of ZWINT mRNA	CTD	PMID:33212167
Zwint	Mouse	arsane	multiple interactions	ISO	RGD:1347195	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ZWINT more ...	CTD	PMID:39836092
Zwint	Mouse	arsenic atom	multiple interactions	ISO	RGD:1347195	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ZWINT more ...	CTD	PMID:39836092
Zwint	Mouse	arsenite(3-)	multiple interactions	ISO	RGD:1347195	6480464	arsenite promotes the reaction [G3BP1 protein binds to ZWINT mRNA]	CTD	PMID:32406909
Zwint	Mouse	arsenous acid	increases expression	ISO	RGD:1347195	6480464	Arsenic Trioxide results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	azathioprine	decreases expression	ISO	RGD:1347195	6480464	Azathioprine results in decreased expression of ZWINT mRNA	CTD	PMID:22623647
Zwint	Mouse	benzbromarone	affects expression	ISO	RGD:628671	6480464	Benzbromarone affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	benzo[a]pyrene	decreases expression	ISO	RGD:1347195	6480464	Benzo(a)pyrene results in decreased expression of ZWINT mRNA	CTD	PMID:20064835\|PMID:21802500
Zwint	Mouse	benzo[a]pyrene	increases expression	ISO	RGD:1347195	6480464	Benzo(a)pyrene results in increased expression of ZWINT mRNA	CTD	PMID:32234424
Zwint	Mouse	benzo[a]pyrene	multiple interactions	EXP		6480464	[Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of more ...	CTD	PMID:14625279
Zwint	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of ZWINT mRNA	CTD	PMID:14625279\|PMID:19770486\|PMID:21569818
Zwint	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1347195	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of ZWINT mRNA	CTD	PMID:20382639
Zwint	Mouse	bicalutamide	decreases expression	ISO	RGD:1347195	6480464	bicalutamide results in decreased expression of ZWINT mRNA	CTD	PMID:15638997
Zwint	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of ZWINT mRNA	CTD	PMID:19850644
Zwint	Mouse	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of ZWINT mRNA]	CTD	PMID:19850644
Zwint	Mouse	bisphenol A	increases expression	ISO	RGD:1347195	6480464	bisphenol A results in increased expression of ZWINT mRNA	CTD	PMID:16474171
Zwint	Mouse	bisphenol A	multiple interactions	ISO	RGD:628671	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Zwint	Mouse	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ZWINT mRNA	CTD	PMID:33221593
Zwint	Mouse	bisphenol A	affects expression	ISO	RGD:1347195	6480464	bisphenol A affects the expression of ZWINT mRNA	CTD	PMID:30903817
Zwint	Mouse	bisphenol A	decreases expression	ISO	RGD:1347195	6480464	bisphenol A results in decreased expression of ZWINT mRNA	CTD	PMID:29275510
Zwint	Mouse	bisphenol A	increases expression	ISO	RGD:628671	6480464	bisphenol A results in increased expression of ZWINT mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016
Zwint	Mouse	Bisphenol A diglycidyl ether	affects splicing	EXP		6480464	bisphenol A diglycidyl ether affects the splicing of ZWINT mRNA	CTD	PMID:36464114
Zwint	Mouse	bisphenol AF	affects splicing	EXP		6480464	bisphenol AF affects the splicing of ZWINT mRNA	CTD	PMID:36464114
Zwint	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of ZWINT mRNA	CTD	PMID:38685157
Zwint	Mouse	bisphenol F	multiple interactions	ISO	RGD:628671	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ...	CTD	PMID:36041667
Zwint	Mouse	cadmium dichloride	affects expression	ISO	RGD:628671	6480464	Cadmium Chloride affects the expression of ZWINT mRNA	CTD	PMID:22110744
Zwint	Mouse	calcitriol	multiple interactions	ISO	RGD:1347195	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of ZWINT mRNA	CTD	PMID:21592394
Zwint	Mouse	calcitriol	decreases expression	ISO	RGD:1347195	6480464	Calcitriol results in decreased expression of ZWINT mRNA	CTD	PMID:21592394
Zwint	Mouse	carbon nanotube	increases expression	EXP		6480464	Nanotubes, Carbon analog results in increased expression of ZWINT mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681\|PMID:25620056
Zwint	Mouse	chromium atom	increases expression	ISO	RGD:1347195	6480464	Chromium results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	chromium(6+)	affects expression	EXP		6480464	chromium hexavalent ion affects the expression of ZWINT mRNA	CTD	PMID:28472532
Zwint	Mouse	chromium(6+)	multiple interactions	ISO	RGD:1347195	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ...	CTD	PMID:38479592
Zwint	Mouse	cisplatin	increases expression	ISO	RGD:1347195	6480464	Cisplatin results in increased expression of ZWINT mRNA	CTD	PMID:27594783
Zwint	Mouse	cisplatin	multiple interactions	ISO	RGD:1347195	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of ZWINT mRNA	CTD	PMID:27392435
Zwint	Mouse	clofibrate	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of ZWINT mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Zwint	Mouse	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of ZWINT mRNA	CTD	PMID:17585979\|PMID:23811191
Zwint	Mouse	clofibrate	affects expression	ISO	RGD:628671	6480464	Clofibrate affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	cobalt dichloride	decreases expression	ISO	RGD:1347195	6480464	cobaltous chloride results in decreased expression of ZWINT mRNA	CTD	PMID:19320972
Zwint	Mouse	copper(II) sulfate	decreases expression	ISO	RGD:1347195	6480464	Copper Sulfate results in decreased expression of ZWINT mRNA	CTD	PMID:19549813
Zwint	Mouse	coumarin	increases expression	ISO	RGD:628671	6480464	coumarin results in increased expression of ZWINT mRNA	CTD	PMID:18480146
Zwint	Mouse	coumestrol	increases expression	ISO	RGD:1347195	6480464	Coumestrol results in increased expression of ZWINT mRNA	CTD	PMID:19167446
Zwint	Mouse	coumestrol	multiple interactions	ISO	RGD:1347195	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ZWINT mRNA; [Coumestrol co-treated with resveratrol] more ...	CTD	PMID:19167446
Zwint	Mouse	crocidolite asbestos	decreases expression	EXP		6480464	Asbestos, Crocidolite results in decreased expression of ZWINT mRNA	CTD	PMID:29279043
Zwint	Mouse	cyclosporin A	decreases expression	ISO	RGD:1347195	6480464	Cyclosporine results in decreased expression of ZWINT mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:25562108
Zwint	Mouse	D-glucose	multiple interactions	ISO	RGD:628671	6480464	ZWINT protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency]	CTD	PMID:21124846
Zwint	Mouse	DDE	increases expression	ISO	RGD:1347195	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of ZWINT mRNA	CTD	PMID:38568856
Zwint	Mouse	dexamethasone	multiple interactions	ISO	RGD:1347195	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Zwint	Mouse	diallyl trisulfide	decreases expression	ISO	RGD:1347195	6480464	diallyl trisulfide results in decreased expression of ZWINT mRNA	CTD	PMID:34995734
Zwint	Mouse	diarsenic trioxide	increases expression	ISO	RGD:1347195	6480464	Arsenic Trioxide results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of ZWINT mRNA	CTD	PMID:21266533
Zwint	Mouse	dicrotophos	decreases expression	ISO	RGD:1347195	6480464	dicrotophos results in decreased expression of ZWINT mRNA	CTD	PMID:28302478
Zwint	Mouse	dioxygen	multiple interactions	ISO	RGD:628671	6480464	ZWINT protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency]	CTD	PMID:21124846
Zwint	Mouse	dioxygen	multiple interactions	EXP		6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ZWINT mRNA; [sulforaphane more ...	CTD	PMID:30529165
Zwint	Mouse	dioxygen	decreases expression	ISO	RGD:1347195	6480464	Oxygen deficiency results in decreased expression of ZWINT mRNA	CTD	PMID:26516004
Zwint	Mouse	dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate	increases expression	ISO	RGD:1347195	6480464	Antimony Potassium Tartrate results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	doxorubicin	affects response to substance	ISO	RGD:1347195	6480464	ZWINT protein affects the susceptibility to Doxorubicin	CTD	PMID:16217747
Zwint	Mouse	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of ZWINT mRNA	CTD	PMID:25896364
Zwint	Mouse	elemental selenium	decreases expression	ISO	RGD:1347195	6480464	Selenium results in decreased expression of ZWINT mRNA	CTD	PMID:19244175
Zwint	Mouse	endosulfan	increases expression	ISO	RGD:628671	6480464	Endosulfan results in increased expression of ZWINT mRNA	CTD	PMID:29391264
Zwint	Mouse	Enterolactone	multiple interactions	ISO	RGD:1347195	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ZWINT mRNA	CTD	PMID:19167446
Zwint	Mouse	epoxiconazole	decreases expression	EXP		6480464	epoxiconazole results in decreased expression of ZWINT mRNA	CTD	PMID:35436446
Zwint	Mouse	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of ZWINT mRNA	CTD	PMID:30319688
Zwint	Mouse	ethanol	affects splicing	EXP		6480464	Ethanol affects the splicing of ZWINT mRNA	CTD	PMID:30319688
Zwint	Mouse	finasteride	increases expression	ISO	RGD:628671	6480464	Finasteride results in increased expression of ZWINT mRNA	CTD	PMID:24136188
Zwint	Mouse	fipronil	decreases expression	ISO	RGD:628671	6480464	fipronil results in decreased expression of ZWINT mRNA	CTD	PMID:34044035
Zwint	Mouse	flavonoids	decreases expression	ISO	RGD:628671	6480464	Flavonoids results in decreased expression of ZWINT mRNA	CTD	PMID:18035473
Zwint	Mouse	flutamide	increases expression	ISO	RGD:628671	6480464	Flutamide results in increased expression of ZWINT mRNA	CTD	PMID:24136188
Zwint	Mouse	folic acid	multiple interactions	EXP		6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZWINT mRNA	CTD	PMID:22206623
Zwint	Mouse	fulvestrant	decreases expression	ISO	RGD:1347195	6480464	fulvestrant results in decreased expression of ZWINT mRNA	CTD	PMID:19016759
Zwint	Mouse	fulvestrant	multiple interactions	ISO	RGD:1347195	6480464	[fulvestrant co-treated with Sirolimus] results in decreased expression of ZWINT mRNA	CTD	PMID:19016759
Zwint	Mouse	genistein	increases expression	ISO	RGD:1347195	6480464	Genistein results in increased expression of ZWINT mRNA	CTD	PMID:16474171
Zwint	Mouse	glucose	multiple interactions	ISO	RGD:628671	6480464	ZWINT protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency]	CTD	PMID:21124846
Zwint	Mouse	GSK-J4	decreases expression	ISO	RGD:1347195	6480464	GSK-J4 results in decreased expression of ZWINT mRNA	CTD	PMID:29301935
Zwint	Mouse	hypochlorous acid	increases expression	EXP		6480464	Hypochlorous Acid results in increased expression of ZWINT mRNA	CTD	PMID:19376150
Zwint	Mouse	indole-3-methanol	affects expression	ISO	RGD:628671	6480464	indole-3-carbinol affects the expression of ZWINT mRNA	CTD	PMID:21396975
Zwint	Mouse	indole-3-methanol	multiple interactions	ISO	RGD:628671	6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of ZWINT mRNA	CTD	PMID:22129741
Zwint	Mouse	indometacin	multiple interactions	ISO	RGD:1347195	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Zwint	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ZWINT mRNA	CTD	PMID:36331819
Zwint	Mouse	L-ethionine	affects expression	ISO	RGD:628671	6480464	Ethionine affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	leflunomide	increases expression	ISO	RGD:628671	6480464	leflunomide results in increased expression of ZWINT mRNA	CTD	PMID:24136188
Zwint	Mouse	lucanthone	decreases expression	ISO	RGD:1347195	6480464	Lucanthone results in decreased expression of ZWINT mRNA	CTD	PMID:21148553
Zwint	Mouse	menadione	affects expression	ISO	RGD:1347195	6480464	Vitamin K 3 affects the expression of ZWINT mRNA	CTD	PMID:20044591
Zwint	Mouse	mercury atom	increases expression	ISO	RGD:1347195	6480464	Mercury results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	mercury dichloride	increases expression	ISO	RGD:628671	6480464	Mercuric Chloride results in increased expression of ZWINT mRNA	CTD	PMID:16507785
Zwint	Mouse	mercury(0)	increases expression	ISO	RGD:1347195	6480464	Mercury results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	methidathion	increases expression	EXP		6480464	methidathion results in increased expression of ZWINT mRNA	CTD	PMID:34813904
Zwint	Mouse	miconazole	decreases expression	EXP		6480464	Miconazole results in decreased expression of ZWINT mRNA	CTD	PMID:27462272
Zwint	Mouse	N-methyl-4-phenylpyridinium	decreases expression	ISO	RGD:1347195	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of ZWINT mRNA	CTD	PMID:24810058
Zwint	Mouse	N-methylformamide	affects expression	EXP		6480464	methylformamide affects the expression of ZWINT mRNA; methylformamide analog affects the expression of ZWINT mRNA	CTD	PMID:17040096
Zwint	Mouse	N-nitrosodiethylamine	multiple interactions	ISO	RGD:628671	6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of ZWINT mRNA	CTD	PMID:22129741
Zwint	Mouse	N-Nitrosopyrrolidine	decreases expression	ISO	RGD:1347195	6480464	N-Nitrosopyrrolidine results in decreased expression of ZWINT mRNA	CTD	PMID:32234424
Zwint	Mouse	nefazodone	increases expression	ISO	RGD:628671	6480464	nefazodone results in increased expression of ZWINT mRNA	CTD	PMID:24136188
Zwint	Mouse	nickel atom	increases expression	ISO	RGD:1347195	6480464	Nickel results in increased expression of ZWINT mRNA	CTD	PMID:25583101
Zwint	Mouse	niclosamide	decreases expression	ISO	RGD:1347195	6480464	Niclosamide results in decreased expression of ZWINT mRNA	CTD	PMID:36318118
Zwint	Mouse	nimesulide	increases expression	ISO	RGD:628671	6480464	nimesulide results in increased expression of ZWINT mRNA	CTD	PMID:24136188
Zwint	Mouse	nitrates	multiple interactions	EXP		6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ZWINT more ...	CTD	PMID:35964746
Zwint	Mouse	okadaic acid	increases expression	ISO	RGD:1347195	6480464	Okadaic Acid results in increased expression of ZWINT mRNA	CTD	PMID:38832940
Zwint	Mouse	omeprazole	affects expression	ISO	RGD:628671	6480464	Omeprazole affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	palbociclib	decreases expression	ISO	RGD:1347195	6480464	palbociclib results in decreased expression of ZWINT mRNA	CTD	PMID:22869556
Zwint	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of ZWINT mRNA	CTD	PMID:17562736
Zwint	Mouse	paracetamol	increases expression	ISO	RGD:628671	6480464	Acetaminophen results in increased expression of ZWINT mRNA	CTD	PMID:33387578
Zwint	Mouse	paracetamol	decreases expression	ISO	RGD:1347195	6480464	Acetaminophen results in decreased expression of ZWINT mRNA	CTD	PMID:29067470
Zwint	Mouse	paracetamol	increases expression	ISO	RGD:1347195	6480464	Acetaminophen results in increased expression of ZWINT mRNA	CTD	PMID:22230336
Zwint	Mouse	paracetamol	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of ZWINT mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Zwint	Mouse	paraquat	increases expression	ISO	RGD:628671	6480464	Paraquat results in increased expression of ZWINT mRNA	CTD	PMID:32680482
Zwint	Mouse	pentachlorophenol	increases expression	EXP		6480464	Pentachlorophenol results in increased expression of ZWINT mRNA	CTD	PMID:23892564
Zwint	Mouse	perfluorononanoic acid	decreases expression	ISO	RGD:1347195	6480464	perfluoro-n-nonanoic acid results in decreased expression of ZWINT mRNA	CTD	PMID:32588087
Zwint	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ZWINT mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Zwint	Mouse	phorbol 13-acetate 12-myristate	increases expression	ISO	RGD:1347195	6480464	Tetradecanoylphorbol Acetate results in increased expression of ZWINT mRNA	CTD	PMID:19031421
Zwint	Mouse	piperonyl butoxide	increases expression	ISO	RGD:628671	6480464	Piperonyl Butoxide results in increased expression of ZWINT mRNA	CTD	PMID:22484513
Zwint	Mouse	pirinixic acid	affects expression	ISO	RGD:628671	6480464	pirinixic acid affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of ZWINT mRNA	CTD	PMID:18301758\|PMID:18445702\|PMID:20813756\|PMID:23811191
Zwint	Mouse	pirinixic acid	increases expression	ISO	RGD:628671	6480464	pirinixic acid results in increased expression of ZWINT mRNA	CTD	PMID:22484513
Zwint	Mouse	piroxicam	decreases expression	ISO	RGD:1347195	6480464	Piroxicam results in decreased expression of ZWINT mRNA	CTD	PMID:21858171
Zwint	Mouse	potassium chromate	multiple interactions	EXP		6480464	[Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of more ...	CTD	PMID:14625279
Zwint	Mouse	potassium dichromate	increases expression	ISO	RGD:1347195	6480464	Potassium Dichromate results in increased expression of ZWINT mRNA	CTD	PMID:17547211
Zwint	Mouse	potassium dichromate	multiple interactions	EXP		6480464	[Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of more ...	CTD	PMID:14625279
Zwint	Mouse	propanal	decreases expression	ISO	RGD:1347195	6480464	propionaldehyde results in decreased expression of ZWINT mRNA	CTD	PMID:26079696
Zwint	Mouse	quinolin-8-ol	decreases expression	ISO	RGD:1347195	6480464	Oxyquinoline results in decreased expression of ZWINT mRNA	CTD	PMID:21632981
Zwint	Mouse	resveratrol	decreases expression	ISO	RGD:1347195	6480464	resveratrol results in decreased expression of ZWINT mRNA	CTD	PMID:15767336
Zwint	Mouse	resveratrol	multiple interactions	ISO	RGD:1347195	6480464	[Coumestrol co-treated with resveratrol] results in increased expression of ZWINT mRNA	CTD	PMID:19167446
Zwint	Mouse	rotenone	increases expression	ISO	RGD:628671	6480464	Rotenone results in increased expression of ZWINT mRNA	CTD	PMID:28374803
Zwint	Mouse	selenium atom	decreases expression	ISO	RGD:1347195	6480464	Selenium results in decreased expression of ZWINT mRNA	CTD	PMID:19244175
Zwint	Mouse	silicon dioxide	decreases expression	ISO	RGD:1347195	6480464	Silicon Dioxide analog results in decreased expression of ZWINT mRNA	CTD	PMID:23806026
Zwint	Mouse	silver atom	increases expression	EXP		6480464	Silver results in increased expression of ZWINT mRNA	CTD	PMID:27131904
Zwint	Mouse	silver(0)	increases expression	EXP		6480464	Silver results in increased expression of ZWINT mRNA	CTD	PMID:27131904
Zwint	Mouse	sirolimus	multiple interactions	ISO	RGD:1347195	6480464	[fulvestrant co-treated with Sirolimus] results in decreased expression of ZWINT mRNA	CTD	PMID:19016759
Zwint	Mouse	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of ZWINT mRNA	CTD	PMID:25270620
Zwint	Mouse	sodium arsenite	multiple interactions	ISO	RGD:1347195	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ZWINT more ...	CTD	PMID:39836092
Zwint	Mouse	sodium arsenite	decreases expression	ISO	RGD:1347195	6480464	sodium arsenite results in decreased expression of ZWINT mRNA	CTD	PMID:38568856
Zwint	Mouse	sodium arsenite	increases expression	ISO	RGD:1347195	6480464	sodium arsenite results in increased expression of ZWINT mRNA	CTD	PMID:29301061\|PMID:34032870
Zwint	Mouse	sodium dichromate	increases expression	ISO	RGD:628671	6480464	sodium bichromate results in increased expression of ZWINT mRNA	CTD	PMID:25993096
Zwint	Mouse	sotorasib	multiple interactions	ISO	RGD:1347195	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of ZWINT mRNA	CTD	PMID:36139627
Zwint	Mouse	sulforaphane	multiple interactions	EXP		6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of ZWINT mRNA	CTD	PMID:30529165
Zwint	Mouse	sunitinib	decreases expression	ISO	RGD:1347195	6480464	Sunitinib results in decreased expression of ZWINT mRNA	CTD	PMID:31533062
Zwint	Mouse	testosterone	multiple interactions	ISO	RGD:1347195	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of ZWINT mRNA	CTD	PMID:21592394
Zwint	Mouse	testosterone	decreases expression	ISO	RGD:1347195	6480464	Testosterone results in decreased expression of ZWINT mRNA	CTD	PMID:21592394
Zwint	Mouse	tetrachloroethene	increases expression	EXP		6480464	Tetrachloroethylene results in increased expression of ZWINT mRNA	CTD	PMID:28973375
Zwint	Mouse	tetrachloromethane	affects expression	EXP		6480464	Carbon Tetrachloride affects the expression of ZWINT mRNA	CTD	PMID:17484886
Zwint	Mouse	tetrachloromethane	multiple interactions	ISO	RGD:628671	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ZWINT mRNA]	CTD	PMID:31150632
Zwint	Mouse	tetrachloromethane	increases expression	ISO	RGD:628671	6480464	Carbon Tetrachloride results in increased expression of ZWINT mRNA	CTD	PMID:31150632
Zwint	Mouse	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of ZWINT mRNA	CTD	PMID:27339419\|PMID:31919559
Zwint	Mouse	thioacetamide	affects expression	ISO	RGD:628671	6480464	Thioacetamide affects the expression of ZWINT mRNA	CTD	PMID:19483382
Zwint	Mouse	thioacetamide	increases expression	ISO	RGD:628671	6480464	Thioacetamide results in increased expression of ZWINT mRNA	CTD	PMID:23411599\|PMID:34492290
Zwint	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of ZWINT gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Zwint	Mouse	trametinib	multiple interactions	ISO	RGD:1347195	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of ZWINT mRNA	CTD	PMID:36139627
Zwint	Mouse	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of ZWINT mRNA	CTD	PMID:19448997
Zwint	Mouse	trichloroethene	increases expression	ISO	RGD:628671	6480464	Trichloroethylene results in increased expression of ZWINT mRNA	CTD	PMID:17905399
Zwint	Mouse	trimellitic anhydride	increases expression	EXP		6480464	trimellitic anhydride results in increased expression of ZWINT mRNA	CTD	PMID:19042947
Zwint	Mouse	triphenyl phosphate	increases expression	ISO	RGD:628671	6480464	triphenyl phosphate results in increased expression of ZWINT mRNA	CTD	PMID:30589522
Zwint	Mouse	troglitazone	decreases expression	ISO	RGD:1347195	6480464	troglitazone results in decreased expression of ZWINT mRNA	CTD	PMID:19140230
Zwint	Mouse	urethane	decreases expression	ISO	RGD:1347195	6480464	Urethane results in decreased expression of ZWINT mRNA	CTD	PMID:28818685
Zwint	Mouse	valdecoxib	increases expression	ISO	RGD:628671	6480464	valdecoxib results in increased expression of ZWINT mRNA	CTD	PMID:24136188
Zwint	Mouse	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of ZWINT mRNA	CTD	PMID:17292431
Zwint	Mouse	valproic acid	affects expression	ISO	RGD:1347195	6480464	Valproic Acid affects the expression of ZWINT mRNA	CTD	PMID:25979313
Zwint	Mouse	valproic acid	decreases methylation	ISO	RGD:1347195	6480464	Valproic Acid results in decreased methylation of ZWINT gene	CTD	PMID:29154799
Zwint	Mouse	vancomycin	decreases expression	EXP		6480464	Vancomycin results in decreased expression of ZWINT mRNA	CTD	PMID:18930951
Zwint	Mouse	vincaleukoblastine	affects response to substance	ISO	RGD:1347195	6480464	ZWINT protein affects the susceptibility to Vinblastine	CTD	PMID:16217747

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	cell division	involved_in	IEA	UniProtKB-KW:KW-0132	2290270		UniProt	GO_REF:0000043
Zwint	Mouse	establishment of localization in cell	involved_in	IBA	PANTHER:PTN001585499\|UniProtKB:O95229\|MGI:1289227	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	establishment of localization in cell	involved_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	homologous chromosome orientation in meiotic metaphase I	involved_in	IMP		2290270	PMID:26486467	UniProt	PMID:26486467
Zwint	Mouse	mitotic sister chromatid segregation	involved_in	IBA	PANTHER:PTN001585499\|UniProtKB:O95229	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	mitotic sister chromatid segregation	involved_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	mitotic sister chromatid segregation	involved_in	IEA	UniProtKB:O95229\|ensembl:ENSP00000363055	2290270		Ensembl	GO_REF:0000107
Zwint	Mouse	mitotic spindle assembly checkpoint signaling	involved_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	mitotic spindle assembly checkpoint signaling	involved_in	IEA	UniProtKB:O95229\|ensembl:ENSP00000363055	2290270		Ensembl	GO_REF:0000107
Zwint	Mouse	mitotic spindle assembly checkpoint signaling	involved_in	IBA	PANTHER:PTN001585499\|UniProtKB:O95229	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	regulation of meiosis I spindle assembly checkpoint	involved_in	IMP		2290270	PMID:26486467	UniProt	PMID:26486467

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	cytoplasm	located_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	cytosol	is_active_in	IBA	PANTHER:PTN001585499\|UniProtKB:O95229	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	cytosol	located_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	cytosol	located_in	IEA	UniProtKB:O95229\|ensembl:ENSP00000363055	2290270		Ensembl	GO_REF:0000107
Zwint	Mouse	dendrite	is_active_in	IBA	PANTHER:PTN001585499\|RGD:628671	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	dendrite	located_in	ISO	RGD:628671	2290270		GO_Central	GO_REF:0000096
Zwint	Mouse	dendrite	located_in	IEA	UniProtKB:Q8VIL3\|ensembl:ENSRNOP00000067414	2290270		Ensembl	GO_REF:0000107
Zwint	Mouse	dendrite		ISO	RGD:628671	9068941		RGD	PMID:12068081\|REF_RGD_ID:633971
Zwint	Mouse	kinetochore	located_in	IDA		2290270	PMID:26486467	UniProt	PMID:26486467
Zwint	Mouse	kinetochore	located_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	kinetochore	located_in	NAS		2290270	PMID:21633384, PMID:23418356	ComplexPortal	PMID:21633384\|PMID:23418356
Zwint	Mouse	kinetochore	is_active_in	IBA	PANTHER:PTN001585499\|UniProtKB:O95229\|MGI:1289227	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	Knl1/Spc105 complex	part_of	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	Knl1/Spc105 complex	part_of	ISS	UniProtKB:O95229	2290270		UniProt	GO_REF:0000024
Zwint	Mouse	nuclear body	located_in	IEA	UniProtKB:O95229\|ensembl:ENSP00000363055	2290270		Ensembl	GO_REF:0000107
Zwint	Mouse	nuclear body	located_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	nuclear body	is_active_in	IBA	PANTHER:PTN001585499\|UniProtKB:O95229	2290270		GO_Central	GO_REF:0000033
Zwint	Mouse	nucleoplasm	located_in	ISO	UniProtKB:O95229	2290270		GO_Central	GO_REF:0000119
Zwint	Mouse	outer kinetochore	part_of	ISO	RGD:1347195	9068941	PMID:24530301	UniProt	PMID:24530301

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	protein binding		ISO	RGD:3728	9068941		RGD	PMID:12068081\|REF_RGD_ID:633971
Zwint	Mouse	protein binding	enables	IPI	PR:P15331-1\|PR:P15331-2	2290270	PMID:25113441	MGI	PMID:25113441

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zwint	Mouse	abnormal inner cell mass morphology		IEA		5509061		MGI
Zwint	Mouse	embryonic lethality prior to organogenesis		IEA		5509061		MGI
Zwint	Mouse	embryonic lethality prior to organogenesis, complete penetrance		IEA		5509061		MGI
Zwint	Mouse	hyperactivity		IEA		5509061		MGI
Zwint	Mouse	preweaning lethality, complete penetrance		IEA		5509061		MGI
Zwint	Mouse	small embryonic epiblast		IEA		5509061		MGI

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (ISO)

(1->4)-beta-D-glucan (EXP)

1,1-dichloroethene (EXP)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dinitrotoluene (ISO)

2,6-dinitrotoluene (ISO)

2-butoxyethanol (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-amino-2,6-dinitrotoluene (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-propyl-2-thiouracil (ISO)

acetamide (ISO)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (ISO)

antimony(0) (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzbromarone (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bicalutamide (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

bisphenol AF (EXP)

bisphenol F (EXP,ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (EXP)

chromium atom (ISO)

chromium(6+) (EXP,ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

coumestrol (ISO)

crocidolite asbestos (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dioxygen (EXP,ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

doxorubicin (EXP,ISO)

elemental selenium (ISO)

endosulfan (ISO)

Enterolactone (ISO)

epoxiconazole (EXP)

ethanol (EXP)

finasteride (ISO)

fipronil (ISO)

flavonoids (ISO)

flutamide (ISO)

folic acid (EXP)

fulvestrant (ISO)

genistein (ISO)

glucose (ISO)

GSK-J4 (ISO)

hypochlorous acid (EXP)

indole-3-methanol (ISO)

indometacin (ISO)

inulin (EXP)

L-ethionine (ISO)

leflunomide (ISO)

lucanthone (ISO)

menadione (ISO)

mercury atom (ISO)

mercury dichloride (ISO)

mercury(0) (ISO)

methidathion (EXP)

miconazole (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-methylformamide (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

nefazodone (ISO)

nickel atom (ISO)

niclosamide (ISO)

nimesulide (ISO)

nitrates (EXP)

okadaic acid (ISO)

omeprazole (ISO)

palbociclib (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentachlorophenol (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP)

phorbol 13-acetate 12-myristate (ISO)

piperonyl butoxide (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

potassium chromate (EXP)

potassium dichromate (EXP,ISO)

propanal (ISO)

quinolin-8-ol (ISO)

resveratrol (ISO)

rotenone (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (EXP)

silver(0) (EXP)

sirolimus (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (ISO)

sotorasib (ISO)

sulforaphane (EXP)

sunitinib (ISO)

testosterone (ISO)

tetrachloroethene (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (ISO)

titanium dioxide (EXP)

trametinib (ISO)

trichloroethene (EXP,ISO)

trimellitic anhydride (EXP)

triphenyl phosphate (ISO)

troglitazone (ISO)

urethane (ISO)

valdecoxib (ISO)

valproic acid (EXP,ISO)

vancomycin (EXP)

vincaleukoblastine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

establishment of localization in cell (IBA,ISO)

homologous chromosome orientation in meiotic metaphase I (IMP)

mitotic sister chromatid segregation (IBA,IEA,ISO)

mitotic spindle assembly checkpoint signaling (IBA,IEA,ISO)

regulation of meiosis I spindle assembly checkpoint (IMP)

Cellular Component

cytoplasm (ISO)

cytosol (IBA,IEA,ISO)

dendrite (IBA,IEA,ISO)

kinetochore (IBA,IDA,ISO,NAS)

Knl1/Spc105 complex (ISO,ISS)

nuclear body (IBA,IEA,ISO)

nucleoplasm (ISO)

outer kinetochore (ISO)

Molecular Function

protein binding (IPI,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal inner cell mass morphology (IEA)

embryonic lethality prior to organogenesis (IEA)

embryonic lethality prior to organogenesis, complete penetrance (IEA)

hyperactivity (IEA)

preweaning lethality, complete penetrance (IEA)

small embryonic epiblast (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:10349636	PMID:10725249	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:14610273	PMID:15489334	PMID:15782199
PMID:16141072	PMID:16141073	PMID:16602821	PMID:18625232	PMID:19554387	PMID:19799774	PMID:20360068	PMID:21267068	PMID:21633384	PMID:21677750	PMID:21873635	PMID:22737085
PMID:23418356	PMID:25113441	PMID:26486467	PMID:28609438	PMID:31138677	PMID:32325033	PMID:32554809	PMID:34321999	PMID:36417873	PMID:38355793

Genomics

Comparative Map Data

Zwint
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	72,490,678 - 72,510,796 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	72,490,677 - 72,510,796 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	72,654,846 - 72,674,964 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	72,654,845 - 72,674,964 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	72,117,643 - 72,132,537 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	72,050,213 - 72,070,263 (+)	NCBI		MGSCv36	mm8
Celera	10	73,721,825 - 73,736,719 (+)	NCBI		Celera
Cytogenetic Map	10	B5.3	NCBI
cM Map	10	37.15	NCBI

ZWINT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	56,357,227 - 56,361,273 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	56,357,227 - 56,361,273 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	58,116,988 - 58,121,034 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	57,787,205 - 57,791,040 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	57,787,204 - 57,791,040	NCBI
Celera	10	51,380,359 - 51,384,194 (-)	NCBI		Celera
Cytogenetic Map	10	q21.1	NCBI
HuRef	10	52,100,166 - 52,104,002 (-)	NCBI		HuRef
CHM1_1	10	58,399,021 - 58,402,856 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	57,207,567 - 57,211,612 (-)	NCBI		T2T-CHM13v2.0

Zwint
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	15,502,559 - 15,953,701 (-)	NCBI		GRCr8
mRatBN7.2	20	15,938,157 - 15,953,997 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	15,938,157 - 15,953,957 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	16,649,159 - 16,664,966 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	16,004,145 - 16,019,952 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	16,476,752 - 16,492,559 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	17,075,781 - 17,091,715 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	17,075,771 - 17,091,766 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	19,258,272 - 19,274,238 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	20	17,366,344 - 17,382,150 (-)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

Zwint
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	10,477,331 - 10,486,288 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	10,477,224 - 10,486,372 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZWINT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	68,652,375 - 68,660,157 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	68,657,697 - 68,665,829 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	52,978,892 - 52,986,797 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	55,202,564 - 55,206,450 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	55,202,383 - 55,206,450 (-)	Ensembl	panpan1.1		panPan2

ZWINT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	32,432,385 - 32,459,377 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	32,432,406 - 32,453,162 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	32,311,125 - 32,367,927 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	33,957,126 - 34,013,841 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	26	31,858,877 - 31,915,636 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	31,447,375 - 31,504,073 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	32,649,687 - 32,706,484 (+)	NCBI		UU_Cfam_GSD_1.0

Zwint
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	72,225,358 - 72,237,265 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936693	1,539,987 - 1,551,685 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZWINT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	94,094,894 - 94,102,060 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	94,094,781 - 94,109,447 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	102,560,703 - 102,610,775 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZWINT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	74,912,070 - 74,915,920 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	74,912,093 - 74,915,926 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	35,825,925 - 35,829,966 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zwint
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	7,528,426 - 7,534,553 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624791	7,528,452 - 7,534,182 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zwint
514 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	1338
Count of miRNA genes:	664
Interacting mature miRNAs:	832
Transcripts:	ENSMUST00000020081, ENSMUST00000105431, ENSMUST00000159549, ENSMUST00000160128, ENSMUST00000160337, ENSMUST00000163046
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302035	Lmb4_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		10	66848187	92258673	Mouse
1300882	Ath17_m	atherosclerosis 17 (mouse)			Not determined		10	51091490	85091639	Mouse
39128215	Lwq17_m	liver weight QTL 17 (mouse)					10	12704051	84079784	Mouse
26884447	Sklq9_m	skull length QTL 9, 10 week (mouse)					10	67335830	111735905	Mouse
4141943	W6q6_m	weight 6 weeks QTL 6 (mouse)			Not determined			12704051	84079784	Mouse
1301787	Bsc1_m	brain size control 1 (mouse)			Not determined		10	58516969	92517096	Mouse
27226772	Tibl13_m	tibia length 13, 10 week (mouse)					10	18875748	129635869	Mouse
1357656	Hrtq3_m	heart weight QTL 3 (mouse)			Not determined		10	12704051	84079784	Mouse
14746991	Manh68_m	mandible shape 68 (mouse)					10	52280497	86280497	Mouse
26884426	Cvht1_m	cranial vault height 1, 5 week (mouse)					10	24675898	121035905	Mouse
10045641	Jckm3_m	juvenile cystic kidney modifier 3 (mouse)			Not determined		10	49848187	83848412	Mouse
26884424	Zlq9_m	zygomatic length QTL 9, 16 week (mouse)					10	63935779	115935905	Mouse
4142380	W3q11_m	weight 3 weeks QTL 11 (mouse)			Not determined			12704051	84079784	Mouse
27226764	Tibl19_m	tibia length 19, 16 week (mouse)					10	39175996	129635869	Mouse
26884430	Zlq5_m	zygomatic length QTL 5, 10 week (mouse)					10	67835830	124835905	Mouse
1357825	Kidpq2_m	kidney weight percentage QTL 2 (mouse)			Not determined		10	12704051	84079784	Mouse
1302150	Bbaa18_m	B.burgdorferi-associated arthritis 18 (mouse)			Not determined		10	49338012	83338157	Mouse
4142313	Angvq1_m	angiogenesis by VEGF QTL 1 (mouse)			Not determined			46720403	82491121	Mouse
1301380	Cia8_m	collagen induced arthritis QTL 8 (mouse)			Not determined		10	51493400	82491121	Mouse
1301386	Sysbp1_m	systolic blood pressure 1 (mouse)			Not determined		10	10108265	87401095	Mouse
1301966	Lifespan2_m	life span 2 (mouse)			Not determined		10	49848222	83848397	Mouse
1302067	Scc9_m	colon tumor susceptibility 9 (mouse)			Not determined		10	18259333	125575232	Mouse
26884411	Bzwq8_m	bi-zygomatic width QTL 8, 10 week (mouse)					10	44876096	115935905	Mouse
1300597	Skull14_m	skull morphology 14 (mouse)			Not determined		10	49848187	83848412	Mouse
4142169	Pbwg16_m	postnatal body weight growth 16 (mouse)			Not determined		10	49848187	83848412	Mouse
1300533	Aem3_m	anti-erythrocyte autoantibody modifier 3 (mouse)			Not determined		10	65490938	99491121	Mouse
26884403	Cvht8_m	cranial vault height 8, 16 week (mouse)					10	22875899	91035862	Mouse
26884407	Bzwq14_m	bi-zygomatic width QTL 14, 16 wee (mouse)					10	45476096	120635905	Mouse
1301502	Eae17_m	susceptibility to experimental allergic encephalomyelitis 17 (mouse)			Not determined		10	51091490	85091639	Mouse
26884405	Huml2_m	humerus length 2, 5 week (mouse)					10	69735830	130430862	Mouse
4141070	Ltgq1_m	liver triglyceride QTL 1 (mouse)			Not determined			41237326	75237326	Mouse
1558757	Eae34_m	experimental allergic encephalomyelitis susceptibility 34 (mouse)			Not determined		10	21408154	114217230	Mouse
1357740	Obsty3_m	obesity 3 (mouse)			Not determined		10	8235478	116190980	Mouse
26884450	Sklq15_m	skull length QTL 15, 16 week (mouse)					10	59335822	122335905	Mouse
13208560	Wght9_m	weight 9 (mouse)					10	59835822	120835905	Mouse
27095911	Pglq15_m	pelvic girdle length QTL 15, 16 week (mouse)					10	39175996	129635869	Mouse
1301737	Insq9_m	insulin QTL 9 (mouse)			Not determined		10	65490938	99491121	Mouse
4141956	Egq7_m	early growth QTL 7 (mouse)			Not determined			12704051	84079784	Mouse
1357864	Scfpq1_m	subcutaneous fat pad percentage QTL 1 (mouse)			Not determined		10	12704051	84079784	Mouse
1357737	Hpcr2_m	hepatocarcinogen resistance 2 (mouse)			Not determined		10	49848222	83848397	Mouse
4142272	W10q5_m	weight 10 weeks QTL 5 (mouse)			Not determined			12704051	84079784	Mouse
1302060	El3_m	epilepsy 3 (mouse)			Not determined		10	65490938	99491121	Mouse

Markers in Region

UniSTS:236377

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	72,674,649 - 72,674,840	UniSTS	GRCm38
MGSCv37	10	72,137,397 - 72,137,588	UniSTS	GRCm37
Celera	10	73,741,581 - 73,741,772	UniSTS
Cytogenetic Map	10	B5.3	UniSTS

UniSTS:236378

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	72,669,596 - 72,669,702	UniSTS	GRCm38
MGSCv37	10	72,132,344 - 72,132,450	UniSTS	GRCm37
Celera	10	73,736,526 - 73,736,632	UniSTS
Cytogenetic Map	10	B5.3	UniSTS

D10Ertd749e

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	72,674,633 - 72,674,880	UniSTS	GRCm38
MGSCv37	10	72,137,381 - 72,137,628	UniSTS	GRCm37
Celera	10	73,741,565 - 73,741,812	UniSTS
Cytogenetic Map	10	B5.3	UniSTS
cM Map	10	38.0	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001293683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001293684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_025635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC153870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK004305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK013556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK075977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK082215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK134380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK170637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK182584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK184469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC013559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC027100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC029087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC034870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY240779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000020081 ⟹ ENSMUSP00000020081

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	72,490,677 - 72,510,796 (+)	Ensembl
GRCm38.p6 Ensembl	10	72,654,845 - 72,674,964 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000105431 ⟹ ENSMUSP00000101071

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	72,490,727 - 72,505,621 (+)	Ensembl
GRCm38.p6 Ensembl	10	72,654,895 - 72,669,789 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000160128

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	72,491,275 - 72,492,430 (+)	Ensembl
GRCm38.p6 Ensembl	10	72,655,443 - 72,656,598 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000160337 ⟹ ENSMUSP00000124429

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	72,490,728 - 72,504,997 (+)	Ensembl
GRCm38.p6 Ensembl	10	72,654,896 - 72,669,165 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000163046

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	72,492,069 - 72,493,220 (+)	Ensembl
GRCm38.p6 Ensembl	10	72,656,237 - 72,657,388 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000219352 ⟹ ENSMUSP00000151725

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	72,492,076 - 72,492,927 (+)	Ensembl
GRCm38.p6 Ensembl	10	72,656,244 - 72,657,095 (+)	Ensembl

RefSeq Acc Id:

NM_001293683 ⟹ NP_001280612

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	72,490,678 - 72,510,796 (+)	NCBI
GRCm38	10	72,654,846 - 72,674,964 (+)	NCBI
Celera	10	73,721,776 - 73,741,896 (+)	NCBI

Sequence:

show sequence

ACTTACCCAGAAACCAATCTCGACCTAGGCGGGCAGTCCAGGAGAATCCAAAGGCGTGGTGAGC
GACAGAACGATGGCGGACGCGGAGAAAAACGCTGTTGCGGAGAAAAACAACGCTGTTGCGACGA
AAGAGGTTCTGGCTGAGGCAGCAGCCATTCTAGAACCTGTAGGCTTGCAGGAAGAAGCAGAGCT
GCCTGCCAAGATCATGGAGGAGTTTATGAGGAACTCGCGGAAGAAAGACAAACTGCTCTGTAGC
CAGCTTCAAGTAGTGAACTTCTTACAGACTTTTCTGGCTCAGGAGGACACTGAGCAGAGCCCTG
ATGCTCTGGCTTCTGAAGATGCCAGTCGGCAAAAGGCAACTGAAACTAAGGAGCAGTGGAAGGA
CATGAAGGCCACATACATGGATCACGTGGATGTCATAAAATGTGCCCTGTCTGAGGCCTTACCC
CAGGTTAAAGAGGCTCACAGGAAGTACACAGAGCTTCAGAAGGCTTTTGAGCAACTCGAGGCTA
AGAAGCGAGTCCTTGAGGAGAAACTTCAGCTGGCTCAGAAGCAGTGGGTACTGCAACAGAAGCG
TTTGCAGAACCTGACAAAGATTTCTGCAGAGGTCAAGAGGCGCCGGAAGAGGGCTCTGGAGAAG
CTTGACGGATCCCATCAGGAACTGGAAACCTTGAAGCAGCAAGCGGGGCAGGAACAGGAGAAGC
TGCAGAGGAACCAGAGCTACCTCCAGCTGCTGTGTTCGCTGCAGAATAAGCTGGTCATCTCTGA
GGGCAAGGCTGAGGACAAAGATGTGAAAGGGCGAGCCCTTACAGCCAAATCCAAATCTCCTTAA
AGATGAAAGGATGAGAAGAGAGCCGTATTCATACCCTGCTTGGGCTGAGACCAGATTGGTTCCT
TCACTGTTGTATCTCTAGGCCTAAGCCTGGAAGTTTGTTGCCTCTGTACAATCTAATTCTCCAA
GCTGATTCAATCTGGCATCTCTTGGCTTTTCAGTGAACTGTTGTGTTTTGTCTCATGCTAACTT
TGACAGTATATTCTGGCTTGTTCTGTCTTCACCTGTGTCTAACTTGCTGTCCTTGCAACCTGTC
TCTGTAAAAGTGTACCAGTGAAACTCACACGCATGCATGCACGCACACAGGCACGCATGCCACA
ACCACCCTTTTCTCTCGCTGATCTTCAGTAGTCTCTCCTCTTGTCCTCTCTTTTTCTTTGTCTT
CTCTCCCTACCAGATGTGAAAGCAACTTTATGCGCCTGCTGTAATTGTTGTCTGAGGATTACTG
CGAGTAAGCTCACCCTTTGTAGTTACTAAACTGGCCGGCTGGCTGGGTCAGCTCCGCTGTACTG
GTTCATAACCCGGCTTCAAGTTGACTGATTCAAAGGGGCCTCTCTTGGCTTCTGACTGAACTGC
TCTGCTTGGAAAGTCTGATGGACTTCAGGAACAGAACTGTACTGACTGCCCTGACTCAGCTGAA
CTCAACTACACCAAATTCATTGGTTCTCTCTGCTGTACTGCTCTTAGGTAGCCTCTCTCCTGTG
CTGTCCTCCTGAGTCGTGCTGTCAAATCTCTCTCTGATTCATCACTTTGCCCCTCAATTAGACT
GGCAGTTTCAAACACGGCACTTAACATTTCAGTTGTAGTCACTTGATACTGCATTCCGAACTTG
AGTCTATTGAATCCAGAATGTGAATCCATGCCTTTGTGACTGTGACCTCACTCTCTTCAGTATT
GTGTAAAAGTTTTAGGAACTCTCCAAGTAAATACTTGGTAATTGCTCATTGATAGAACAGAAAA
ATGCTGTGTAGATAATAAATAAACATATAACTATAAGATTAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001293684 ⟹ NP_001280613

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	72,490,678 - 72,505,625 (+)	NCBI
GRCm38	10	72,654,846 - 72,669,793 (+)	NCBI
Celera	10	73,721,776 - 73,741,896 (+)	NCBI

Sequence:

show sequence

ACTTACCCAGAAACCAATCTCGACCTAGGCGGGCAGTCCAGGAGAATCCAAAGGCGTGGTGAGC
GACAGAACGATGGCGGACGCGGAGAAAAACGCTGTTGCGGAGAAAAACAACGCTGTTGCGACGA
AAGAGGTTCTGGCTGAGGCAGCAGCCATTCTAGAACCTGTAGGCTTGCAGGAAGAAGCAGAGCT
GCCTGCCAAGATCATGGAGGAGTTTATGAGGAACTCGCGGAAGAAAGACAAACTGCTCTGTAGC
CAGCTTCAAGTAGTGAACTTCTTACAGACTTTTCTGGCTCAGGAGGACACTGAGCAGAGCCCTG
ATGCTCTGGCTTCTGAAGATGCCAGTCGGCAAAAGGCAACTGAAACTAAGGAGCAGTGGAAGGA
CATGAAGGCCACATACATGGATCACGTGGATGTCATAAAATGTGCCCTGTCTGAGGCCTTACCC
CAGGTTAAAGAGGCTCACAGGAAGTACACAGAGCTTCAGAAGGCTTTTGAGCAACTCGAGGCTA
AGAAGCGAGTCCTTGAGGAGAAACTTCAGCTGGCTCAGAAGCAGTGGGTACTGCAACAGAAGCG
TTTGCAGAACCTGACAAAGATTTCTGCAGAGGTCAAGAGGCGCCGGAAGAGGGCTCTGGAGAAG
CTTGACGGATCCCATCAGGAACTGGAAACCTTGAAGCAGCAAGCGGGGCAGGAACAGGAGAAGC
TGCAGAGGAACCAGAGCTACCTCCAGCTGCTGTGTTCGCTGCAGAATAAGCTGGTCATCTCTGA
GGGCAAGGCTGAGGACAAAGATGTGAAAGGGCGAGCCCTTACAGCCAAATCCAAATCTCCTTAA
AGGGACAAAGAAGAACACTGGTTTGGCCTGGAACACCTTTTCTACTGAGAATGAGAAGTGGCCT
GATATACTTATAGCTTGACAAGTGAGATGGTTTGATGATGTCTTCAAGAGCTAAGGAGAAGGGA
CTGAAAGAAATTTAGTTAAGATTGAAAGCTGGTTGTGAAGCCTGTTAGCAGATCTTCAGGATGG
ACGTAGTGAGATGCAGCAAACCTGTTCTTTGCCTGAAGAACCTGCAACAAGACTTTGTGGCCTG
GATTGTTGACCCATTGCATGGATATGGACTTTCTGGGAAACCTTAGATTGTTGGAAACATTTAT
GGGAATAGGAATCTTTCATTAAATACCTCAATTTTCTTTGTTGTTGATGTTGTTGTTATAGCAC
AATCTACCGTATTCTGCCTGATTTAAGATAAAGAGCATAAAAATAGTGCTAGCTTGTGAGAGTT
AGCCTGCCAAGGACTGTGAGGGCTAGATAGTGAGAGGTTGGAATTGAGCCAAGACACACTGATG
ATAAAATAGGTGGAGGAGTAGTGAAGATAGTTGCTGAAGTATGCCAGGCTTTAGTTTTATTTAG
AAAAAACCATAAGCCTTTATTACATTTCTGTTTGATAATTATCTGAGCCCCCAAACTTCTCCTC
AAATAGTCTGTTTTAAAAGTACAATTTATTTACTTCCATTTATCTGAAGATATGTGCCTTCCAT
TTCTAATTTGAAAGTGCTCAGAGTAAATCTTAGGATAGGTTAGTTAACATCAGCTGATGTCTTT
GTCTACTTTTGAGTCTGAGGACACCAGTGATACTTAATTGGGTCTTACTCTGTGCTTTCATTTT
TACTTGACTATTGTTTTAAAGCCTCATTTCCAAACAAAGTCACAAAGAGCCACTGAAGGCTAGA
TTTTTGTAACTATTAAACAGTAAAAAGTATGCTACATGTATAAGATGTATAAATACTTATTTAA
GAATTATATAAGAGTATTCTGAAA

hide sequence

RefSeq Acc Id:

NM_025635 ⟹ NP_079911

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	72,490,678 - 72,505,625 (+)	NCBI
GRCm38	10	72,654,846 - 72,669,793 (+)	NCBI
MGSCv37	10	72,117,643 - 72,132,537 (+)	RGD
Celera	10	73,721,776 - 73,741,896 (+)	NCBI
cM Map	10		ENTREZGENE

Sequence:

show sequence

ACTTACCCAGAAACCAATCTCGACCTAGGCGGGCAGTCCAGGAGAATCCAAAGGCGTGGTGAGC
GACAGAACGATGGCGGACGCGGAGAAAAACGCTGTTGCGGAGAAAAACAACGCTGTTGCGACGA
AAGAGGTTCTGGCTGAGGCAGCAGCCATTCTAGAACCTGTAGGCTTGCAGGAAGAAGCAGAGCT
GCCTGCCAAGATCATGGAGGAGTTTATGAGGAACTCGCGGAAGAAAGACAAACTGCTCTGTAGC
CAGCTTCAAGTAGTGAACTTCTTACAGACTTTTCTGGCTCAGGAGGACACTGAGCAGAGCCCTG
ATGCTCTGGCTTCTGAAGATGCCAGTCGGCAAAAGGCAACTGAAACTAAGGAGCAGTGGAAGGA
CATGAAGGCCACATACATGGATCACGTGGATGTCATAAAATGTGCCCTGTCTGAGGCCTTACCC
CAGGTTAAAGAGGCTCACAGGAAGTACACAGAGCTTCAGAAGGCTTTTGAGCAACTCGAGGCTA
AGAAGCGAGTCCTTGAGGAGAAACTTCAGCTGGCTCAGAAGCAGTGGGTACTGCAACAGAAGCG
TTTGCAGAACCTGACAAAGATTTCTGCAGAGGTCAAGAGGCGCCGGAAGAGGGCTCTGGAGAAG
CTTGACGGATCCCATCAGGAACTGGAAACCTTGAAGCAGCAAGCGGGGCAGGAACAGGAGAAGC
TGCAGAGGAACCAGAGCTACCTCCAGCTGCTGTGTTCGCTGCAGAATAAGCTGGTCATCTCTGA
GGGCAAGGCTGAGGACAAAGATGTGAAAGGGCGAGCCCTTACAGCCAAATCCAAATCTCCTTAA
AGGGTGAAAACATTGATGGGTGAAATTTGCCTTTTTGCACCGCATTTATGGATCATCTTGAAAA
AGAAATGAGTGCTTCCAAACCACTCAGTGAAGGAGGAGACGAAGCAGCTTTGTAAACCGCAAAG
TTAAATCCACCTACTGTACAGCTGTCCTGCAACGAGAGCATTGAGTGAGAAGACAGCAGGGAAG
GAAGAACATTCCAGGGGAAGTGGCAGTTGCCATGGGGTGGTGGTGGTTATGAAAATGCATGAGT
AAAGGAAAATAATTCTGCACTAAGATAAAGCAAAAAGCCATAGCGTGAGGACTGAGCCCAGCTA
ACAGGATACTGGACATGAGCCTCTCTGAGGGAGACATGTCAGTGAGAAGCTTTGAGTCTATAAA
CTGATAAGGACCACATTGACTTCTCTGTACAGATTAGACCAGGGATGATAGGTTTGAAATACAG
ATATTTAGAATTTATGGTTGTATTAACAAGATTGAAAGATGACTAAGATCTGGGTTAGGAATTG
TTGGCAGAAACGTGGTAAATCTTGTGGTTATTGGATAGATTTAGGCTGTTTTACTTATACCATT
GATTGGACGTTAAGTGTTTGAACTATATATTGGGGGAATTCCAAAGTTTCTTTATTCTGAACTG
GTAGGATCCAGTTCTGTGCTGACATAAAGAATTGACAGGGCTGGACCTTAACCAAGAAACAGCT
TATGGTAGGTGTACAATTGAGATTTGTCCAAGTGGTACACTTGACCACTGCATTCATGTGTCTA
AGGACCATTGAGCAGACGGGAATTATGCAGCTTCACTCCATCTAGGGCTGAGATGGCTAAGAAC
ACAAAAGTATGGTAACAACTAGAGATAGGCTGACACGGTCAGCTTCAACACCTGTTATATTATG
CATGTTTGTATTTTGAAAGGGACAAAGAAGAACACTGGTTTGGCCTGGAACACCTTTTCTACTG
AGAATGAGAAGTGGCCTGATATACTTATAGCTTGACAAGTGAGATGGTTTGATGATGTCTTCAA
GAGCTAAGGAGAAGGGACTGAAAGAAATTTAGTTAAGATTGAAAGCTGGTTGTGAAGCCTGTTA
GCAGATCTTCAGGATGGACGTAGTGAGATGCAGCAAACCTGTTCTTTGCCTGAAGAACCTGCAA
CAAGACTTTGTGGCCTGGATTGTTGACCCATTGCATGGATATGGACTTTCTGGGAAACCTTAGA
TTGTTGGAAACATTTATGGGAATAGGAATCTTTCATTAAATACCTCAATTTTCTTTGTTGTTGA
TGTTGTTGTTATAGCACAATCTACCGTATTCTGCCTGATTTAAGATAAAGAGCATAAAAATAGT
GCTAGCTTGTGAGAGTTAGCCTGCCAAGGACTGTGAGGGCTAGATAGTGAGAGGTTGGAATTGA
GCCAAGACACACTGATGATAAAATAGGTGGAGGAGTAGTGAAGATAGTTGCTGAAGTATGCCAG
GCTTTAGTTTTATTTAGAAAAAACCATAAGCCTTTATTACATTTCTGTTTGATAATTATCTGAG
CCCCCAAACTTCTCCTCAAATAGTCTGTTTTAAAAGTACAATTTATTTACTTCCATTTATCTGA
AGATATGTGCCTTCCATTTCTAATTTGAAAGTGCTCAGAGTAAATCTTAGGATAGGTTAGTTAA
CATCAGCTGATGTCTTTGTCTACTTTTGAGTCTGAGGACACCAGTGATACTTAATTGGGTCTTA
CTCTGTGCTTTCATTTTTACTTGACTATTGTTTTAAAGCCTCATTTCCAAACAAAGTCACAAAG
AGCCACTGAAGGCTAGATTTTTGTAACTATTAAACAGTAAAAAGTATGCTACATGTATAAGATG
TATAAATACTTATTTAAGAATTATATAAGAGTATTCTGAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001280612	(Get FASTA)	NCBI Sequence Viewer
	NP_001280613	(Get FASTA)	NCBI Sequence Viewer
	NP_079911	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH13559	(Get FASTA)	NCBI Sequence Viewer
	AAH27100	(Get FASTA)	NCBI Sequence Viewer
	AAH34870	(Get FASTA)	NCBI Sequence Viewer
	BAB23256	(Get FASTA)	NCBI Sequence Viewer
	BAB25492	(Get FASTA)	NCBI Sequence Viewer
	BAB28904	(Get FASTA)	NCBI Sequence Viewer
	BAC36090	(Get FASTA)	NCBI Sequence Viewer
	BAE22123	(Get FASTA)	NCBI Sequence Viewer
	EDL31942	(Get FASTA)	NCBI Sequence Viewer
	EDL31943	(Get FASTA)	NCBI Sequence Viewer
	EDL31944	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000020081
	ENSMUSP00000020081.5
	ENSMUSP00000101071
	ENSMUSP00000101071.2
	ENSMUSP00000124429
	ENSMUSP00000124429.2
GenBank Protein	Q9CQU5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_079911 ⟸ NM_025635

- UniProtKB:

Q91VI4 (UniProtKB/Swiss-Prot), Q3UYT8 (UniProtKB/Swiss-Prot), Q9D0W9 (UniProtKB/Swiss-Prot), Q9CQU5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIMEEFMRNSRKKDKLLCSQLQ
VVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKDMKATYMDHVDVIKCALSEALPQVK
EAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDG
SHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISEGKAEDKDVKGRALTAKSKSP

hide sequence

RefSeq Acc Id:

NP_001280612 ⟸ NM_001293683

- UniProtKB:

Q91VI4 (UniProtKB/Swiss-Prot), Q3UYT8 (UniProtKB/Swiss-Prot), Q9D0W9 (UniProtKB/Swiss-Prot), Q9CQU5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIMEEFMRNSRKKDKLLCSQLQ
VVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKDMKATYMDHVDVIKCALSEALPQVK
EAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDG
SHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISEGKAEDKDVKGRALTAKSKSP

hide sequence

RefSeq Acc Id:

NP_001280613 ⟸ NM_001293684

- UniProtKB:

Q91VI4 (UniProtKB/Swiss-Prot), Q3UYT8 (UniProtKB/Swiss-Prot), Q9D0W9 (UniProtKB/Swiss-Prot), Q9CQU5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIMEEFMRNSRKKDKLLCSQLQ
VVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKDMKATYMDHVDVIKCALSEALPQVK
EAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKISAEVKRRRKRALEKLDG
SHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISEGKAEDKDVKGRALTAKSKSP

hide sequence

Ensembl Acc Id:

ENSMUSP00000101071 ⟸ ENSMUST00000105431

Ensembl Acc Id:

ENSMUSP00000020081 ⟸ ENSMUST00000020081

Ensembl Acc Id:

ENSMUSP00000151725 ⟸ ENSMUST00000219352

Ensembl Acc Id:

ENSMUSP00000124429 ⟸ ENSMUST00000160337

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CQU5-F1-model_v2	AlphaFold	Q9CQU5	1-252	view protein structure

Promoters

RGD ID:

6820125

Promoter ID:

MM_KWN:4512

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6

Transcripts:

NM_025635, OTTMUST00000071881, OTTMUST00000071884, OTTMUST00000071885, OTTMUST00000071886, OTTMUST00000071887, UC007FOY.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	10	72,117,351 - 72,119,152 (+)	MPROMDB

RGD ID:

8672278

Promoter ID:

EPDNEW_M14169

Type:

initiation region

Name:

Zwint_1

Description:

Mus musculus ZW10 interactor , transcript variant 2, mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	10	72,654,880 - 72,654,940	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1289227	AgrOrtholog
Ensembl Genes	ENSMUSG00000019923	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000020081	ENTREZGENE
	ENSMUST00000020081.11	UniProtKB/Swiss-Prot
	ENSMUST00000105431	ENTREZGENE
	ENSMUST00000105431.8	UniProtKB/Swiss-Prot
	ENSMUST00000160337	ENTREZGENE
	ENSMUST00000160337.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.4090	UniProtKB/Swiss-Prot
InterPro	Zwint-1	UniProtKB/Swiss-Prot
KEGG Report	mmu:52696	UniProtKB/Swiss-Prot
MGD	MGI:1289227	ENTREZGENE
NCBI Gene	52696	ENTREZGENE
PANTHER	PTHR31504	UniProtKB/Swiss-Prot
	ZW10 INTERACTOR	UniProtKB/Swiss-Prot
Pfam	Zwint	UniProtKB/Swiss-Prot
PhenoGen	Zwint	PhenoGen
UniProt	A0A1W2P7M1_MOUSE	UniProtKB/TrEMBL
	Q3UYT8	ENTREZGENE
	Q91VI4	ENTREZGENE
	Q9CQU5	ENTREZGENE
	Q9D0W9	ENTREZGENE
	ZWINT_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q3UYT8	UniProtKB/Swiss-Prot
	Q91VI4	UniProtKB/Swiss-Prot
	Q9D0W9	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD

Mammalian Phenotype