Zp3 (zona pellucida glycoprotein 3)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Zp3 (zona pellucida glycoprotein 3) Mus musculus

Analyze

Symbol:

Zp3

Name:

zona pellucida glycoprotein 3

RGD ID:

732255

MGI Page

MGI

Description:

Enables receptor ligand activity. A structural constituent of egg coat. Involved in several processes, including oogenesis; positive regulation of acrosome reaction; and regulation of gene expression. Acts upstream of or within binding activity of sperm to zona pellucida. Located in collagen-containing extracellular matrix and plasma membrane. Is expressed in ovary and testis. Orthologous to human ZP3 (zona pellucida glycoprotein 3).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

sperm receptor; zona pellucida glycoprotein ZP3; zona pellucida protein C; zona pellucida sperm-binding protein 3; Zp-; Zp-3

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZP3 (zona pellucida glycoprotein 3)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Zp3 (zona pellucida glycoprotein 3)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZP3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zp3 (zona pellucida glycoprotein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	POMZP3 (POM121 and ZP3 fusion)	HGNC	Ensembl, OrthoDB, PhylomeDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Zp3 (zona pellucida glycoprotein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ZP3 (zona pellucida glycoprotein 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3b (zona pellucida glycoprotein 3b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	zp3a.1 (zona pellucida glycoprotein 3a, tandem duplicate 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:173556	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3a.2 (zona pellucida glycoprotein 3a, tandem duplicate 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3.2 (zona pellucida glycoprotein 3, tandem duplicate 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zp3e	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	136,008,959 - 136,017,478 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	5	136,008,953 - 136,017,478 (+)	Ensembl
GRCm38	5	135,980,105 - 135,988,624 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,980,099 - 135,988,624 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	136,455,975 - 136,464,494 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	5	136,264,732 - 136,273,251 (+)	NCBI			mm8
Celera	5	132,991,486 - 133,024,448 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	75.62	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chromosome 7q11.23 Deletion Syndrome, Distal, 1.2-MB (ISO)

Oocyte Maturation Defect 3 (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (ISO)

aristolochic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bexarotene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

dexamethasone (ISO)

genistein (EXP)

hydrogen peroxide (ISO)

methimazole (ISO)

N-methyl-4-phenylpyridinium (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

rotenone (ISO)

sulforaphane (ISO)

temozolomide (ISO)

testosterone (ISO)

triclosan (ISO)

triptonide (EXP)

valproic acid (ISO)

vinclozolin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

binding of sperm to zona pellucida (IBA,IDA,IGI,IMP,IPI,ISO)

blastocyst formation (IMP)

egg coat formation (IBA,IMP)

humoral immune response mediated by circulating immunoglobulin (IDA)

negative regulation of binding of sperm to zona pellucida (ISO)

negative regulation of DNA-templated transcription (IDA)

oocyte development (IMP)

positive regulation of acrosomal vesicle exocytosis (ISO)

positive regulation of acrosome reaction (IBA,IDA,ISO)

positive regulation of antral ovarian follicle growth (IMP)

positive regulation of DNA-templated transcription (IDA)

positive regulation of humoral immune response (ISO)

positive regulation of inflammatory response (IDA)

positive regulation of interleukin-4 production (IDA)

positive regulation of leukocyte migration (IDA)

positive regulation of ovarian follicle development (IDA,IMP)

positive regulation of T cell proliferation (IDA)

positive regulation of type II interferon production (IDA)

positive regulation of type IV hypersensitivity (IDA)

regulation of signaling receptor activity (IDA,IMP)

Cellular Component

collagen-containing extracellular matrix (IDA,ISO)

egg coat (ISO)

extracellular matrix (IBA)

extracellular region (IEA)

extracellular space (ISO)

integral component of membrane (IEA)

membrane (IEA)

plasma membrane (IDA)

Molecular Function

acrosin binding (IBA,ISO)

carbohydrate binding (ISO)

identical protein binding (ISO)

protein binding (IPI)

receptor ligand activity (IDA,IMP)

structural constituent of egg coat (IMP)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal cumulus oophorus morphology (IAGP)

abnormal embryo development (IAGP)

abnormal oocyte morphology (IAGP)

abnormal ovarian folliculogenesis (IAGP)

abnormal ovulation (IAGP)

absent zona pellucida (IAGP)

decreased litter size (IAGP)

decreased ovary weight (IAGP)

decreased ovulation rate (IAGP)

decreased tertiary ovarian follicle number (IAGP)

failure of zygotic cell division (IAGP)

female infertility (IAGP)

reduced female fertility (IAGP)

small ovary (IAGP)

thin zona pellucida (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	MGD IEA	MGD IEA
3.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1330788	PMID:1358806	PMID:1577197	PMID:1729594	PMID:1794049	PMID:1968044	PMID:2535821	PMID:2541416	PMID:2591314	PMID:2842770	PMID:2884155	PMID:3012564
PMID:3378665	PMID:7478547	PMID:7512897	PMID:7536496	PMID:7545161	PMID:7561067	PMID:7604284	PMID:7613026	PMID:7635043	PMID:7718569	PMID:7797272	PMID:7808217
PMID:7816829	PMID:7822321	PMID:7829060	PMID:7841460	PMID:7873981	PMID:8043949	PMID:8075499	PMID:8089187	PMID:8119734	PMID:8175755	PMID:8305213	PMID:8567692
PMID:8589531	PMID:8643592	PMID:8672430	PMID:8786143	PMID:8787763	PMID:8824813	PMID:8848588	PMID:9002630	PMID:9107049	PMID:9126492	PMID:9237231	PMID:9337408
PMID:9344682	PMID:9374408	PMID:9434941	PMID:9442021	PMID:9476659	PMID:9494100	PMID:9521869	PMID:9609824	PMID:9878248	PMID:9988213	PMID:10049595	PMID:10198163
PMID:10349636	PMID:10433265	PMID:10440843	PMID:10603086	PMID:10605025	PMID:10729725	PMID:10793136	PMID:10922068	PMID:11013070	PMID:11023867	PMID:11042159	PMID:11076861
PMID:11217851	PMID:11291774	PMID:11352562	PMID:11417900	PMID:11501764	PMID:11739644	PMID:11779826	PMID:11869186	PMID:11892795	PMID:11906903	PMID:11940668	PMID:12079642
PMID:12466851	PMID:12477932	PMID:12589785	PMID:12799386	PMID:12852850	PMID:14610273	PMID:14645511	PMID:14670992	PMID:14673092	PMID:14972104	PMID:15079052	PMID:15128590
PMID:15317747	PMID:15326356	PMID:15379548	PMID:15579591	PMID:15970507	PMID:16141072	PMID:16141073	PMID:16245311	PMID:16416028	PMID:16672355	PMID:16690745	PMID:17007971
PMID:17047254	PMID:17258189	PMID:17290430	PMID:17369397	PMID:18354036	PMID:18420282	PMID:18667753	PMID:19014927	PMID:19052627	PMID:20382503	PMID:20616279	PMID:21378311
PMID:21873635	PMID:22685254	PMID:23417405	PMID:24357321	PMID:24552588	PMID:24934154	PMID:28145526	PMID:28646452	PMID:30122633	PMID:31657143	PMID:34736966

Genomics

Comparative Map Data

Zp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	136,008,959 - 136,017,478 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	5	136,008,953 - 136,017,478 (+)	Ensembl
GRCm38	5	135,980,105 - 135,988,624 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,980,099 - 135,988,624 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	136,455,975 - 136,464,494 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	5	136,264,732 - 136,273,251 (+)	NCBI			mm8
Celera	5	132,991,486 - 133,024,448 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	75.62	NCBI

ZP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	76,397,522 - 76,442,069 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	7	76,397,518 - 76,442,071 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	76,026,839 - 76,071,386 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	75,864,804 - 75,909,324 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	7	75,671,518 - 75,716,038	NCBI
Celera	7	70,895,359 - 70,931,910 (+)	NCBI
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	71,113,333 - 71,158,989 (+)	NCBI		HuRef
CHM1_1	7	75,957,109 - 76,001,648 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	77,685,187 - 77,730,456 (+)	NCBI
CRA_TCAGchr7v2	7	75,359,905 - 75,404,452 (+)	NCBI

Zp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	20,690,547 - 20,697,513 (-)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	12	20,690,547 - 20,697,513 (-)	Ensembl
Rnor_6.0	12	23,735,225 - 23,752,734 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	23,735,223 - 23,742,190 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	25,733,873 - 25,740,838 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	21,805,746 - 21,812,711 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	12	21,792,837 - 21,799,583 (-)	NCBI
Celera	12	22,453,873 - 22,460,838 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

Zp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955456	15,013,472 - 15,020,809 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	7	82,872,676 - 82,891,655 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	82,844,162 - 82,891,655 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	7	67,574,932 - 67,592,757 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

ZP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	7,586,212 - 7,594,610 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	7,585,970 - 7,594,610 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	9,281,828 - 9,290,191 (+)	NCBI
ROS_Cfam_1.0	6	7,406,839 - 7,415,182 (+)	NCBI
ROS_Cfam_1.0 Ensembl	6	7,406,839 - 7,415,182 (+)	Ensembl
UMICH_Zoey_3.1	6	7,375,722 - 7,384,085 (+)	NCBI
UNSW_CanFamBas_1.0	6	7,338,676 - 7,347,061 (+)	NCBI
UU_Cfam_GSD_1.0	6	7,501,843 - 7,510,213 (+)	NCBI

Zp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	132,014,297 - 132,023,299 (+)	NCBI
SpeTri2.0	NW_004936543	2,013,231 - 2,022,270 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	9,934,761 - 9,944,941 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	9,934,760 - 9,944,924 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	9,837,980 - 9,848,145 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	3	pter-p15	NCBI

ZP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	10,534,383 - 10,579,828 (+)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	28	10,562,455 - 10,579,825 (+)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666070	5,838,035 - 5,855,397 (-)	NCBI	Vero_WHO_p1.0

Zp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	15,037,943 - 15,044,193 (+)	Ensembl	HetGla_female_1.0		hetGla2
HetGla 1.0	NW_004624740	15,037,818 - 15,044,207 (+)	NCBI	HetGla_female_1.0		hetGla2

Position Markers

X14376

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	135,988,474 - 135,988,624	UniSTS	GRCm38
MGSCv37	5	136,464,344 - 136,464,494	UniSTS	GRCm37
Celera	5	133,000,010 - 133,000,160	UniSTS
Cytogenetic Map	5	G2	UniSTS
cM Map	5	77.0	UniSTS
Whitehead/MRC_RH	5	1647.08	UniSTS

PMC140591P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	135,987,252 - 135,987,761	UniSTS	GRCm38
MGSCv37	5	136,463,122 - 136,463,631	UniSTS	GRCm37
Celera	5	133,007,354 - 133,007,863	UniSTS
Cytogenetic Map	5	G2	UniSTS
cM Map	5	77.0	UniSTS

Zp3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	135,980,134 - 135,980,319	UniSTS	GRCm38
MGSCv37	5	136,456,004 - 136,456,189	UniSTS	GRCm37
Celera	5	132,991,515 - 132,991,700	UniSTS
Cytogenetic Map	5	G2	UniSTS
cM Map	2	77.0	UniSTS
cM Map	5	77.0	UniSTS
cM Map	5	77.0	UniSTS
cM Map	5	77.0	UniSTS

Zp3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	135,988,429 - 135,988,586	UniSTS	GRCm38
MGSCv37	5	136,464,299 - 136,464,456	UniSTS	GRCm37
Celera	5	132,999,965 - 133,000,122	UniSTS
Cytogenetic Map	5	G2	UniSTS
cM Map	5	77.0	UniSTS

Zp3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	5	135,981,122 - 135,981,286	UniSTS	GRCm38
GRCm38	2	135,860,775 - 135,862,337	UniSTS	GRCm38
MGSCv37	5	136,456,992 - 136,457,156	UniSTS	GRCm37
MGSCv37	2	135,686,511 - 135,688,073	UniSTS	GRCm37
Celera	5	132,992,503 - 132,992,667	UniSTS
Celera	2	137,058,133 - 137,059,695	UniSTS
Cytogenetic Map	5	G2	UniSTS
Cytogenetic Map	2	F3	UniSTS
cM Map	5	77.0	UniSTS

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11341716	Rvfs3_m	Rift Valley fever susceptibility 3 (mouse)					5	26441234	138455402	Mouse
27226719	Tibw6_m	tibia width 6, proximal, 16 week (mouse)					5	72857343	139985755	Mouse
1301362	Prnr1_m	prion resistance 1 (mouse)			Not determined		5	89418876	146787935	Mouse
14746986	Manh58_m	mandible shape 58 (mouse)					5	102446283	136446283	Mouse
11532736	Sluc33b_m	susceptibility to lung cancer 33b (mouse)					5	102945037	136945196	Mouse
10412202	Bbaa26_m	B.burgdorferi-associated arthritis 26 (mouse)			Not determined		5	104583688	138555455	Mouse
10412239	Alpq7_m	alcohol preference QTL 7 (mouse)			Not determined		5	104705939	138705939	Mouse
10043890	Trigq4_m	triglyceride QTL 4 (mouse)			Not determined		5	107906299	141906412	Mouse
4142473	Chlq11_m	circulating hormone level QTL 11 (mouse)			Not determined		5	107906299	141906412	Mouse
13464243	Ahl20_m	age related hearing loss, early onset 20 (mouse)					5	107906299	141906412	Mouse
10412197	Bbaa25_m	B.burgdorferi-associated arthritis 25 (mouse)			Not determined		5	109167240	143167381	Mouse
13464251	Ahl21_m	age related hearing loss, early onset 21 (mouse)					5	109167240	143167381	Mouse
1301543	Hypch_m	hypercholesterolemia (mouse)			Not determined		5	109238624	139118905	Mouse
1300913	Bwefm_m	body weight females and males day 10 (mouse)			Not determined		5	109439348	143439459	Mouse
1301102	Cia14_m	collagen induced arthritis 14 (mouse)			Not determined		5	113320385	138555455	Mouse
1301226	Bbaa2_m	B.burgdorferi-associated arthritis 2 (mouse)			Not determined		5	115156883	149157015	Mouse
1300827	Cora1_m	correlation in cytokine production 1 (mouse)			Not determined		5	115156883	149157015	Mouse
1301857	Bglq14_m	body growth late QTL 14 (mouse)			Not determined		5	118948964	151758149	Mouse
10412191	Bbaa24_m	B.burgdorferi-associated arthritis 24 (mouse)			Not determined		5	119945037	141700466	Mouse
4141081	Nidd7k_m	Nidd7 on KK-A (mouse)			Not determined			119945037	149347326	Mouse
11528552	Scram1_m	spinal cord resistance to astrocytoma modifier 1 (mouse)					5	121455402	151758149	Mouse
1301986	Bpq4_m	blood pressure QTL 4 (mouse)			Not determined		5	121555236	151758149	Mouse
1302079	Lbw3_m	lupus NZB x NZW 3 (mouse)			Not determined		5	124700335	151758149	Mouse
1301363	Pbwg13_m	postnatal body weight growth 13 (mouse)			Not determined		5	125133457	151758149	Mouse
1301715	Elmaz2_m	elevated maze behavior 2 (mouse)			Not determined		5	125178229	141700466	Mouse
4141218	Ath24_m	atherosclerosis 24 (mouse)			Not determined			129520084	151758149	Mouse
12880406	Jcdq2_m	joint cartilage degeneration QTL 2 (mouse)					5	129787831	151758149	Mouse
13464143	Bbaa2b_m	B.burgdorferi-associated arthritis 2b (mouse)					5	133052969	140709801	Mouse
11049557	Lmr26_m	leishmaniasis resistance 26 (mouse)					5	133925558	151758149	Mouse
14700793	Mencq4_m	meniscus calcification QTL 4 (mouse)					5	135895854	136218854	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	280
Count of miRNA genes:	231
Interacting mature miRNAs:	249
Transcripts:	ENSMUST00000005073, ENSMUST00000131563
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_011776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC087420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK131934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057761	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY057779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M20026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X14376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000005073 ⟹ ENSMUSP00000005073

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	136,008,953 - 136,017,478 (+)	Ensembl
GRCm38.p6 Ensembl	5	135,980,099 - 135,988,624 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000131563 ⟹ ENSMUSP00000120447

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	136,009,022 - 136,016,146 (+)	Ensembl
GRCm38.p6 Ensembl	5	135,980,168 - 135,987,292 (+)	Ensembl

RefSeq Acc Id:

NM_011776 ⟹ NP_035906

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	136,008,959 - 136,017,478 (+)	NCBI
GRCm38	5	135,980,105 - 135,988,624 (+)	ENTREZGENE
MGSCv37	5	136,455,975 - 136,464,494 (+)	RGD
Celera	5	132,991,486 - 133,024,448 (+)	RGD
cM Map	5		ENTREZGENE

Sequence:

show sequence

CTGAGCCCAGCTGTACTCCAGGCGGGACCATGGCGTCAAGCTATTTCCTCTTCCTTTGTCTCCT
GCTGTGTGGAGGCCCCGAGCTGTGCAATTCCCAGACTCTGTGGCTTTTGCCGGGTGGAACTCCC
ACCCCAGTGGGGTCCTCATCACCTGTGAAGGTGGAGTGTCTGGAAGCTGAACTAGTGGTGACTG
TCAGTAGAGACCTTTTTGGCACGGGGAAGCTGGTGCAGCCCGGGGACCTCACCCTTGGCTCAGA
GGGTTGTCAGCCCCGGGTGTCCGTGGATACCGACGTGGTCAGGTTCAACGCCCAGTTGCACGAG
TGCAGCAGCAGGGTGCAGATGACGAAAGATGCCCTGGTGTACAGCACCTTCCTACTCCACGACC
CTCGCCCTGTGAGTGGCCTGTCCATCCTCAGGACTAACCGTGTGGAGGTACCCATTGAGTGCCG
ATACCCCAGGCAGGGCAATGTGAGCAGCCACCCTATCCAGCCCACCTGGGTTCCCTTCAGAGCC
ACTGTGTCCTCAGAGGAGAAACTGGCTTTCTCTCTTCGCCTGATGGAGGAGAACTGGAATACTG
AGAAATCGGCTCCCACCTTCCACCTGGGAGAGGTAGCCCACCTCCAGGCAGAAGTCCAGACTGG
AAGCCACCTGCCGCTGCAGCTGTTTGTGGACCACTGCGTGGCCACGCCTTCACCTTTGCCAGAC
CCGAACTCCTCCCCCTATCACTTCATCGTGGACTTCCACGGTTGCCTTGTGGATGGTCTATCTG
AGAGCTTTTCGGCATTTCAAGTCCCCAGACCCCGGCCAGAGACTCTCCAGTTCACGGTGGATGT
ATTCCATTTTGCCAACAGCTCCAGAAATACGCTCTACATCACCTGCCATCTCAAAGTCGCGCCA
GCTAACCAGATCCCCGATAAGCTCAACAAAGCCTGTTCGTTCAACAAGACTTCCCAGAGTTGGT
TGCCAGTAGAGGGTGATGCTGACATCTGTGATTGCTGCAGCCATGGCAACTGTAGTAATTCAAG
CTCTTCACAGTTCCAGATCCATGGACCCCGCCAGTGGTCCAAGCTAGTTTCTCGAAACCGCAGG
CACGTGACCGATGAAGCTGATGTCACTGTAGGGCCCCTGATATTCCTTGGAAAGGCCAACGACC
AGACTGTGGAAGGCTGGACTGCTTCTGCTCAAACCTCTGTGGCTCTTGGGTTAGGCCTGGCCAC
AGTGGCATTCCTGACCCTGGCAGCTATAGTCCTTGCTGTCACCAGGAAGTGTCACTCCTCTTCC
TACCTTGTATCCCTTCCGCAATAAAAGAAGAAACTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_035906	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB18629	(Get FASTA)	NCBI Sequence Viewer
	AAH99465	(Get FASTA)	NCBI Sequence Viewer
	AAI00746	(Get FASTA)	NCBI Sequence Viewer
	AAI03584	(Get FASTA)	NCBI Sequence Viewer
	AAI03585	(Get FASTA)	NCBI Sequence Viewer
	AAI03586	(Get FASTA)	NCBI Sequence Viewer
	AAL23765	(Get FASTA)	NCBI Sequence Viewer
	AAL23766	(Get FASTA)	NCBI Sequence Viewer
	AAL23767	(Get FASTA)	NCBI Sequence Viewer
	AAL23768	(Get FASTA)	NCBI Sequence Viewer
	AAL23780	(Get FASTA)	NCBI Sequence Viewer
	AAL23781	(Get FASTA)	NCBI Sequence Viewer
	AAL23782	(Get FASTA)	NCBI Sequence Viewer
	AAL23783	(Get FASTA)	NCBI Sequence Viewer
	AAL23795	(Get FASTA)	NCBI Sequence Viewer
	AAL23796	(Get FASTA)	NCBI Sequence Viewer
	AAL23797	(Get FASTA)	NCBI Sequence Viewer
	AAL23798	(Get FASTA)	NCBI Sequence Viewer
	BAE20883	(Get FASTA)	NCBI Sequence Viewer
	CAA32550	(Get FASTA)	NCBI Sequence Viewer
	EDL19338	(Get FASTA)	NCBI Sequence Viewer
	P10761	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_035906 ⟸ NM_011776
- Peptide Label:	preproprotein
- UniProtKB:	P10761 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASSYFLFLCLLLCGGPELCNSQTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGK LVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSIL RTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLG EVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPR PRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADIC DCCSHGNCSNSSSSQFQIHGPRQWSKLVSRNRRHVTDEADVTVGPLIFLGKANDQTVEGWTASA QTSVALGLGLATVAFLTLAAIVLAVTRKCHSSSYLVSLPQ hide sequence

RefSeq Acc Id:

ENSMUSP00000120447 ⟸ ENSMUST00000131563

RefSeq Acc Id:

ENSMUSP00000005073 ⟸ ENSMUST00000005073

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10761-F1-model_v2	AlphaFold	P10761	1-424	view protein structure

Promoters

RGD ID:

6888348

Promoter ID:

EPDNEW_M7625

Type:

single initiation site

Name:

Zp3_1

Description:

Mus musculus zona pellucida glycoprotein 3 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	5	135,980,107 - 135,980,167	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:99215	AgrOrtholog
Ensembl Genes	ENSMUSG00000004948	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000005073	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUSP00000120447.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000005073	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUST00000131563.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.4100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	ZP-C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_dom_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:22788	UniProtKB/Swiss-Prot
MGD	MGI:99215	ENTREZGENE
NCBI Gene	22788	ENTREZGENE
PANTHER	PTHR11576:SF2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Zona_pellucida	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Zp3	PhenoGen
PRINTS	ZPELLUCIDA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ZP_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZP_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00241	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	F6VD35_MOUSE	UniProtKB/TrEMBL
	P10761	ENTREZGENE
	Q3V2B5_MOUSE	UniProtKB/TrEMBL
	ZP3_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q4FZI2	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Mammalian Phenotype