Adora2b (adenosine A2b receptor) - Rat Genome Database

Name: Adora2b
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Adora2b (adenosine A2b receptor) Mus musculus

Analyze

Symbol:

Adora2b

Name:

adenosine A2b receptor

RGD ID:

731020

MGI Page

MGI

Description:

Exhibits G protein-coupled receptor activity. Involved in several processes, including positive regulation of cGMP-mediated signaling; positive regulation of cytokine production; and regulation of regulated secretory pathway. Localizes to Schaffer collateral - CA1 synapse; glutamatergic synapse; and plasma membrane. Is expressed in several structures, including cardiovascular system; central nervous system; eye; genitourinary system; and gut. Orthologous to human ADORA2B (adenosine A2b receptor); PARTICIPATES IN adenosine signaling pathway; INTERACTS WITH (S)-amphetamine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

A2; A2b; A2b, Rs; A2BAR; A2BR; AA; AA2BR; adenosine receptor A2b; AI480866; AI605384; AR; ARA2B; MGC144574; MGC144575

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADORA2B (adenosine A2b receptor)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Adora2b (adenosine A2B receptor)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Adora2b (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADORA2B (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADORA2B (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Adora2b (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADORA2B (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	ADORA2B (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adora2b (adenosine A2b receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADORA2A (adenosine A2a receptor)	HGNC	OrthoDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Adora2b (adenosine A2B receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	ADORA2B (adenosine A2b receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	adora2b (adenosine A2b receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam\|ZFIN)
Drosophila melanogaster (fruit fly):	AdoR	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Caenorhabditis elegans (roundworm):	ador-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	62,139,810 - 62,157,278 (+)	NCBI	GRCm39		mm39
GRCm38	11	62,248,984 - 62,266,452 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	62,248,984 - 62,266,453 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	62,062,486 - 62,079,954 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	11	62,065,179 - 62,082,647 (+)	NCBI			mm8
Celera	11	68,108,085 - 68,109,506 (+)	NCBI		Celera
Cytogenetic Map	11	B2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neoplasm Metastasis (ISO)

Reperfusion Injury (ISO)

Sepsis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-AMPA (ISO)

(S)-amphetamine (EXP)

1,7-dimethylxanthine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (ISO)

4-hydroxynon-2-enal (EXP)

4-hydroxyphenyl retinamide (EXP)

4-tert-butylphenol (ISO)

acetamide (ISO)

acrylamide (ISO)

adenosine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alloxazine (ISO)

ammonium chloride (ISO)

BAY 60-6583 (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

bromobenzene (ISO)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (EXP)

cerium trichloride (EXP)

choline (EXP)

cisplatin (ISO)

cobalt atom (ISO)

cocaine (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cycloheximide (ISO)

cyclosporin A (EXP,ISO)

dexamethasone (ISO)

dextran sulfate (EXP)

diazinon (ISO)

diclofenac (EXP)

dioxygen (EXP)

diquat (ISO)

dorsomorphin (ISO)

DPCPX (ISO)

entinostat (ISO)

ferric oxide (EXP)

folic acid (EXP)

formaldehyde (ISO)

furan (ISO)

indometacin (ISO)

isobutanol (ISO)

L-methionine (EXP)

lead(0) (ISO)

lead(2+) (ISO)

lipopolysaccharide (EXP,ISO)

MeIQx (ISO)

melatonin (EXP)

methotrexate (ISO)

modafinil (ISO)

N-ethyl-5'-carboxamidoadenosine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nitrogen dioxide (ISO)

paracetamol (ISO)

phenobarbital (ISO)

pirinixic acid (EXP)

progesterone (EXP)

propiconazole (ISO)

raloxifene (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium dichromate (ISO)

succimer (EXP)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

tetrachloroethene (EXP)

tetrachloromethane (EXP,ISO)

titanium dioxide (EXP)

tremolite asbestos (EXP)

triadimefon (ISO)

trichloroethene (ISO)

trimellitic anhydride (EXP)

Tungsten carbide (ISO)

tunicamycin (ISO)

valproic acid (EXP,ISO)

vinclozolin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IMP)

cellular response to extracellular stimulus (IDA)

G protein-coupled adenosine receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway (IEA)

negative regulation of cell population proliferation (ISO)

negative regulation of collagen biosynthetic process (ISO)

obsolete positive regulation of blood vessel diameter (ISO)

positive regulation of cAMP-mediated signaling (ISO)

positive regulation of catecholamine secretion (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of cGMP-mediated signaling (IMP)

positive regulation of chemokine production (IMP)

positive regulation of chronic inflammatory response to non-antigenic stimulus (IMP)

positive regulation of endothelial cell migration (ISO)

positive regulation of endothelial cell proliferation (ISO)

positive regulation of guanylate cyclase activity (IMP)

positive regulation of interleukin-6 production (IMP,ISO)

positive regulation of mast cell degranulation (IMP)

positive regulation of norepinephrine secretion (ISO)

positive regulation of steroid biosynthetic process (ISO)

positive regulation of vascular endothelial growth factor production (IMP)

regulation of glucose metabolic process (ISO)

regulation of synaptic vesicle exocytosis (EXP,IMP)

relaxation of vascular associated smooth muscle (IMP)

response to angiotensin (ISO)

signal transduction (IEA)

Cellular Component

cell surface (ISO)

glutamatergic synapse (EXP,IDA,IMP)

integral component of membrane (IEA)

membrane (IEA)

plasma membrane (IDA,ISO)

Schaffer collateral - CA1 synapse (EXP,IC,IMP)

synapse (IDA)

Molecular Function

G protein-coupled adenosine receptor activity (IEA)

G protein-coupled receptor activity (IMP)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

adenosine signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal cellular extravasation (IAGP)

abnormal cytokine level (IAGP)

abnormal dendritic cell physiology (IAGP)

abnormal inflammatory response (IAGP)

abnormal interleukin level (IAGP)

abnormal leukocyte adhesion (IAGP)

abnormal leukocyte migration (IAGP)

abnormal macrophage physiology (IAGP)

abnormal penile erection (IAGP)

abnormal placenta morphology (IAGP)

abnormal response to cardiac infarction (IAGP)

abnormal response to injury (IAGP)

abnormal retinal blood vessel morphology (IEA)

abnormal tumor necrosis factor level (IAGP)

convulsive seizures (IEA)

decreased interleukin-10 secretion (IAGP)

decreased physiological sensitivity to xenobiotic (IAGP)

decreased sensitivity to induced morbidity/mortality (IAGP)

decreased susceptibility to injury (IAGP)

enhanced leukocyte tethering or rolling (IAGP)

impaired adaptive thermogenesis (IAGP)

increased circulating HDL cholesterol level (IEA)

increased circulating interleukin-6 level (IAGP)

increased fasting circulating glucose level (IEA)

increased heart rate (IAGP)

increased interleukin-6 secretion (IAGP)

increased mean systemic arterial blood pressure (IAGP)

increased sensitivity to induced morbidity/mortality (IAGP)

increased susceptibility to injury (IAGP)

increased susceptibility to type I hypersensitivity reaction (IAGP)

increased systemic arterial systolic blood pressure (IAGP)

increased tumor necrosis factor secretion (IAGP)

increased vascular permeability (IAGP)

References

References - curated


1.	MGD and Homologene mouse data transfer
2.	MGD data from the GO Consortium
3.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	RGD automated import pipeline
6.	RGD automated import pipeline for gene-chemical interactions
7.	Stehle JH, etal., Mol Endocrinol 1992 Mar;6(3):384-93.

Additional References at PubMed

PMID:8135856	PMID:8157966	PMID:8889548	PMID:10349636	PMID:10536053	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11454903	PMID:12477932	PMID:12798294	PMID:12817016
PMID:16141072	PMID:16141073	PMID:16177079	PMID:16339566	PMID:16602821	PMID:16679400	PMID:16823489	PMID:16841096	PMID:17200408	PMID:17353435	PMID:17396131	PMID:17525287
PMID:17965229	PMID:17979185	PMID:18032734	PMID:18056839	PMID:18088370	PMID:18184815	PMID:18287559	PMID:18292397	PMID:18340377	PMID:18359773	PMID:18423660	PMID:18424752
PMID:18465770	PMID:18490720	PMID:18536750	PMID:18559975	PMID:18578565	PMID:18591435	PMID:18601927	PMID:18647598	PMID:18714400	PMID:18787641	PMID:18950865	PMID:19158311
PMID:19221436	PMID:19249906	PMID:19249907	PMID:19299692	PMID:19342636	PMID:19342675	PMID:19357134	PMID:19375644	PMID:19494329	PMID:19556606	PMID:19574419	PMID:19707555
PMID:19858092	PMID:20102488	PMID:20185832	PMID:20348420	PMID:20388705	PMID:20505145	PMID:20659747	PMID:20709859	PMID:20797398	PMID:20926384	PMID:20935155	PMID:21098235
PMID:21149612	PMID:21170046	PMID:21242513	PMID:21267068	PMID:21270129	PMID:21270276	PMID:21320567	PMID:21511827	PMID:21557932	PMID:21566208	PMID:21593380	PMID:21622845
PMID:21743001	PMID:21926236	PMID:21949117	PMID:22039302	PMID:22116822	PMID:22116830	PMID:22144568	PMID:22164264	PMID:22219293	PMID:22253866	PMID:22311598	PMID:22389701
PMID:22403399	PMID:22504483	PMID:22707616	PMID:22767505	PMID:22848385	PMID:22894638	PMID:22896040	PMID:22956582	PMID:23045479	PMID:23225885	PMID:23525711	PMID:23584256
PMID:23603835	PMID:23682121	PMID:23827818	PMID:23855769	PMID:23908469	PMID:23922379	PMID:23964122	PMID:24136993	PMID:24145516	PMID:24194503	PMID:24194600	PMID:24262796
PMID:24391213	PMID:24502579	PMID:24614760	PMID:24629340	PMID:24892847	PMID:24928509	PMID:24966910	PMID:25108010	PMID:25318478	PMID:25538227	PMID:25587035	PMID:25704806
PMID:25850656	PMID:26136425	PMID:26147733	PMID:26188061	PMID:26227882	PMID:26317647	PMID:26355158	PMID:26642367	PMID:26654777	PMID:27221704	PMID:27320922	PMID:27404219
PMID:27482003	PMID:27590504	PMID:27626380	PMID:27994068	PMID:28169986	PMID:28238550	PMID:28542132	PMID:28700664	PMID:28701304	PMID:28808842	PMID:28982732	PMID:29047264
PMID:29476752	PMID:29548686	PMID:29662125	PMID:29802128	PMID:29910735	PMID:29935155	PMID:29983349	PMID:30333323	PMID:30530591	PMID:30822301	PMID:31050560	PMID:31263105
PMID:31278195	PMID:31390562	PMID:31434806	PMID:31980601	PMID:32045262	PMID:32122590	PMID:32589947

Genomics

Comparative Map Data

Adora2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	62,139,810 - 62,157,278 (+)	NCBI	GRCm39		mm39
GRCm38	11	62,248,984 - 62,266,452 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	62,248,984 - 62,266,453 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	62,062,486 - 62,079,954 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	11	62,065,179 - 62,082,647 (+)	NCBI			mm8
Celera	11	68,108,085 - 68,109,506 (+)	NCBI		Celera
Cytogenetic Map	11	B2	NCBI

ADORA2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	17	15,944,917 - 15,975,746 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	17	15,927,782 - 15,975,746 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	17	15,848,444 - 15,879,210 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
GRCh37	17	15,848,231 - 15,879,210 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	15,788,956 - 15,819,935 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	17	15,788,955 - 15,819,935	NCBI
Celera	17	15,751,524 - 15,782,216 (+)	NCBI
Cytogenetic Map	17	p12	NCBI
HuRef	17	15,715,812 - 15,746,515 (+)	NCBI		HuRef
CHM1_1	17	15,856,999 - 15,887,687 (+)	NCBI		CHM1_1

Adora2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	46,940,394 - 46,956,772 (+)	NCBI
Rnor_6.0 Ensembl	10	48,569,555 - 48,586,365 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	10	48,569,563 - 48,586,366 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	10	48,358,068 - 48,374,871 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	48,421,592 - 48,437,967 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	10	48,435,217 - 48,451,589 (+)	NCBI
Celera	10	46,186,295 - 46,202,681 (+)	NCBI		Celera
Cytogenetic Map	10	q23	NCBI

Adora2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	1,342,271 - 1,363,138 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	1,342,271 - 1,363,149 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADORA2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Mhudiblu_PPA_v0	17	34,849,466 - 34,880,088 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

ADORA2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	39,884,375 - 39,908,214 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Adora2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936821	583,463 - 608,189 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADORA2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	59,393,220 - 59,449,692 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	59,431,834 - 59,449,701 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ADORA2B
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	15,682,669 - 15,712,079 (-)	NCBI
ChlSab1.1 Ensembl	16	15,683,077 - 15,711,858 (-)	Ensembl

Adora2b
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624877	4,421,307 - 4,447,574 (-)	NCBI

Position Markers

AI605384

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	62,265,866 - 62,266,011	UniSTS	GRCm38
MGSCv37	11	62,079,368 - 62,079,513	UniSTS	GRCm37
Celera	11	68,108,920 - 68,109,065	UniSTS
Cytogenetic Map	11	B2	UniSTS
Whitehead/MRC_RH	11	825.37	UniSTS

AI480866

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	62,266,272 - 62,266,351	UniSTS	GRCm38
MGSCv37	11	62,079,774 - 62,079,853	UniSTS	GRCm37
Celera	11	68,109,326 - 68,109,405	UniSTS
Cytogenetic Map	11	B2	UniSTS
Whitehead/MRC_RH	11	825.57	UniSTS

Adora2b

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	62,265,280 - 62,265,454	UniSTS	GRCm38
MGSCv37	11	62,078,782 - 62,078,956	UniSTS	GRCm37
Celera	11	68,108,334 - 68,108,508	UniSTS
Cytogenetic Map	11	B2	UniSTS
cM Map	UN		UniSTS
cM Map	11		UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
26884446	Sklq10_m	skull length QTL 10, 10 week (mouse)					11	3300000	63000000	Mouse
26884453	Sklq16_m	skull length QTL 16, 16 week (mouse)					11	3300000	72800000	Mouse
13208559	Wght10_m	weight 10 (mouse)					11	4000000	89000000	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	4000000	95000000	Mouse
1300905	Scc6_m	colon tumor susceptibility 6 (mouse)			Not determined		11	6930277	89128908	Mouse
26884401	Huml4_m	humerus length 4, 10 week (mouse)					11	11600000	68600000	Mouse
27226762	Feml21_m	femur length 21, 16 week (mouse)					11	11800000	66100000	Mouse
4141966	Tailq1_m	tail length QTL 1 (mouse)			Not determined			12318637	68609504	Mouse
1357851	Scfq3_m	subcutaneous fat pad weight QTL 3 (mouse)			Not determined		11	12318637	68609504	Mouse
1357437	Epfq4_m	epididymal fat pad weight QTL 4 (mouse)			Not determined		11	12318637	68609504	Mouse
4141127	W3q4_m	weight 3 weeks QTL 4 (mouse)			Not determined			12318637	68609504	Mouse
4142216	Lgq1_m	late growth QTL 1 (mouse)			Not determined			12318637	68609504	Mouse
4142308	W6q3_m	weight 6 weeks QTL 3 (mouse)			Not determined		11	12318637	68609504	Mouse
4141582	Lgaq1_m	late growth adjusted QTL 1 (mouse)			Not determined			12318637	68609504	Mouse
4142109	W10q2_m	weight 10 weeks QTL 2 (mouse)			Not determined			12318637	68609504	Mouse
4141470	Egq4_m	early growth QTL 4 (mouse)			Not determined			12318637	68609504	Mouse
1357640	Orq2_m	ovulation rate QTL 2 (mouse)			Not determined		11	12318637	68609504	Mouse
1357720	Kidpq1_m	kidney weight percentage QTL 1 (mouse)			Not determined		11	12318637	68609504	Mouse
1559002	Lmrq4_m	Leishmania major resistance QTL 4 (mouse)			Not determined		11	12318637	69794121	Mouse
1357859	Lvrq7_m	liver weight QTL 7 (mouse)			Not determined		11	12318637	118131898	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12318637	118131898	Mouse
1558945	Orgwq8_m	organ weight QTL 8 (mouse)			Not determined		11	17106175	67187585	Mouse
10053687	Eae6_m	susceptibility to experimental allergic encephalomyelitis 6 (mouse)			Not determined		11	17831966	68609504	Mouse
4141894	Nidd6k_m	Nidd6 on KK-A (mouse)			Not determined			19174204	97007000	Mouse
10412246	Dfs2_m	dental fluorosis suseptibility 2 (mouse)			Not determined		11	21857364	95990405	Mouse
1357844	Si5lq5_m	serum IGFBP-5 level QTL 5 (mouse)			Not determined		11	28275046	62275149	Mouse
13524848	Ppiq7_m	prepulse inhibition QTL 7 (mouse)					11	28678320	62678320	Mouse
1301426	Desp2_m	despair 2 (mouse)			Not determined		11	28817754	62817873	Mouse
11522752	Cocia18_m	cocaine-induced activity, QTL 18 (mouse)					11	31117382	65117382	Mouse
11059563	Lmr31_m	leishmaniasis resistance 31 (mouse)					11	32209750	66209867	Mouse
1357782	Char8_m	P. chabaudi malaria resistance QTL 8 (mouse)			Not determined		11	35687789	69794161	Mouse
13208569	Bmiq10_m	body mass index QTL 10 (mouse)					11	36000000	85000000	Mouse
1301328	Mol4_m	modifier of LPS-response 4 (mouse)			Not determined		11	36391750	83590530	Mouse
1301788	Lbw8_m	lupus NZB x NZW 8 (mouse)			Not determined		11	36612460	70618665	Mouse
1301896	Tria1_m	T-cell receptor induced activation 1 (mouse)			Not determined		11	36722738	70723028	Mouse
4141853	Skmw17_m	skeletal muscle weight 17 (mouse)			Not determined		11	37190115	71190238	Mouse
10766457	Nwa3_m	New Zealand White autoimmunity 3 (mouse)					11	38125289	72125383	Mouse
11532698	Sluc36a_m	susceptibility to lung cancer 36a (mouse)					11	42365791	76365904	Mouse
11532699	Sluc36b_m	susceptibility to lung cancer 36b (mouse)					11	42365791	76365904	Mouse
4142300	Ctrq3_m	C. trachomatis resistance QTL 3 (mouse)			Not determined		11	44739211	76963931	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44739211	113167183	Mouse
4141000	Nidd3_m	non-insulin-dependent diabetes mellitus 3 (mouse)			Not determined			45151201	79151308	Mouse
1302021	Nidd1n_m	non-insulin-dependent diabetes mellitus 1 in NSY (mouse)			Not determined		11	45275046	80087498	Mouse
1357878	Mastr_m	modifier of astrocytoma (mouse)			Not determined		11	45817754	89927907	Mouse
1300765	Bbaa4_m	B.burgdorferi-associated arthritis 4 (mouse)			Not determined		11	46294341	80294436	Mouse
1301988	Bmd11_m	bone mineral density 11 (mouse)			Not determined		11	46428581	80428696	Mouse
1301830	Ssta4_m	susceptibility to Salmonella typhimurium antigens 4 (mouse)			Not determined		11	50187365	84187585	Mouse
13524840	Ppiq9a_m	prepulse inhibition QTL 9a (mouse)					11	52603559	86603559	Mouse
1300774	Pgia7_m	proteoglycan induced arthritis 7 (mouse)			Not determined		11	53499762	87499911	Mouse
4141084	Spqq1_m	sperm quality QTL 1 (mouse)			Not determined			54174844	63428696	Mouse
1302186	Blmpf2_m	bleomycin-induced pulmonary fibrosis 2 (mouse)			Not determined		11	54174844	67187585	Mouse
4142148	Ckdbp2_m	chronic kidney disease blood pressure locus 2 (mouse)			Not determined		11	54190115	65213015	Mouse
4141830	Pregq1_m	pregnancy QTL 1 (mouse)			Not determined		11	54235926	83842826	Mouse
4141875	Etax9_m	ethanol induced ataxia 9 (mouse)			Not determined			55394159	72319101	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56973201	114267131	Mouse
1300664	Etohcta9_m	ethanol conditioned taste aversion 9 (mouse)			Not determined		11	57863834	91863932	Mouse
10053682	Eae45_m	experimental allergic encephalomyelitis susceptibility 45 (mouse)			Not determined		11	58599729	74863932	Mouse
1300924	Ity2_m	immunity to S. typhimurium 2 (mouse)			Not determined		1	58617204	87804412	Mouse
4141982	Skts-fp2_m	skin tumor susceptibility in FVB and PWK 2 (mouse)			Not determined			58828440	85175703	Mouse
11532697	Sluc36_m	susceptibility to lung cancer 36 (mouse)					11	59365791	69591873	Mouse
1301987	Pid3_m	prior incubation determinant 3 (mouse)			Not determined		11	61795994	88808902	Mouse
1301319	Dautb4_m	dopamine uptake transporter binding 4 (mouse)			Not determined		11	62265179	96265327	Mouse

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir27b	mmu-miR-27b-5p	Mirecords	external_info	{changed}	NA	20388705

Predicted Target Of

	Summary Value
Count of predictions:	182
Count of miRNA genes:	151
Interacting mature miRNAs:	169
Transcripts:	ENSMUST00000018644
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_007413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK047002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK077289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK080759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL596110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U05673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000018644 ⟹ ENSMUSP00000018644

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	11	62,248,984 - 62,266,453 (+)	Ensembl

RefSeq Acc Id:

NM_007413 ⟹ NP_031439

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	62,139,810 - 62,157,278 (+)	NCBI
GRCm38	11	62,248,984 - 62,266,452 (+)	ENTREZGENE
MGSCv37	11	62,062,486 - 62,079,954 (+)	RGD
Celera	11	68,108,085 - 68,109,506 (+)	NCBI
Celera	11	69,173,817 - 69,182,904 (+)	ENTREZGENE
cM Map	11		ENTREZGENE

Sequence:

show sequence

AGACCCAGCTTGGGACGCGCGGTCTCAGCGCTGTGGCCATGCCTGGCGGCACCCTAGCAGCTGT
CCTGAGCCCGACACTACCCCAGTAGAGGACTCCCCGGGCCCGGCTGGCCCGGCCATGCAGCTAG
AGACGCAAGACGCGCTGTACGTGGCGCTGGAGCTGGTTATCGCTGCGCTGGCGGTGGCGGGCAA
CGTGCTGGTGTGCGCCGCGGTGGGAGCCTCGAGTGCATTACAGACCCCCACCAACTACTTTCTG
GTATCCCTGGCGACGGCAGACGTGGCCGTGGGACTCTTCGCCATCCCCTTTGCCATCACCATCA
GCTTGGGCTTCTGCACGGACTTCCACGGCTGCCTCTTCCTCGCCTGCTTCGTGCTGGTGCTCAC
ACAGAGCTCCATCTTTAGCCTCTTGGCGGTGGCTGTCGACCGATATCTGGCCATTCGCGTCCCG
CTCAGGTATAAAGGTTTGGTCACTGGGACACGAGCGAGAGGGATCATTGCTGTCCTCTGGGTCC
TTGCCTTTGGCATTGGATTGACTCCGTTCCTGGGGTGGAACAGTAAAGACAGTGCCACCAGCAA
CTGCACAGAACTGGGGGATGGCATCGCGAATAAAAGCTGCTGTCCTGTGACATGTCTCTTTGAG
AATGTGGTCCCCATGAGCTACATGGTGTATTTCAACTTCTTTGGGTGTGTCCTTCCTCCACTGC
TCATAATGCTGGTGATCTACATCAAAATCTTCATGGTGGCCTGCAAGCAGCTTCAGCGCATGGA
ACTGATGGACCACTCCAGGACCACTCTCCAGCGGGAGATCCACGCAGCCAAGTCACTGGCTATG
ATCGTGGGCATTTTTGCTCTGTGTTGGCTCCCAGTGCATGCCATCAACTGTATCACCCTCTTCC
ATCCAGCCCTGGCCAAGGACAAGCCCAAGTGGGTGATGAATGTGGCCATCCTCCTGTCACATGC
CAATTCAGTTGTCAACCCCATTGTCTATGCCTACAGGAACCGAGACTTCCGCTACAGTTTCCAC
AAGATCATCTCCAGATATGTTCTCTGCCAGGCCGAGACCAAGGGTGGGAGTGGGCAGGCTGGGG
CGCAGTCTACTCTCAGTCTGGGCTTATGACCTAGGCTCTGGCCTTTTGGAGAAGAAGGCTTAAA
ATAAACAATGGGACTAGACACAACTGGCCGATCCTCACTGTGAAAGACAGCTGCACCTCCCAAG
CAAATGGCCCGTCTCCCCTGAATGCTTGCCTGGAGTTACACAAGTCTGGCTGACATGCAAATTG
GAGGCTCCGTGGCTAACAAATACATTTATGAATCTATTCAGCTGCTCTTACTGTGTGGATGGTG
GTGGCAGCTTGAATTGATTCCGGAAAACTGTTTAAGAATCTGCCTCATTCGTGGTAGAAAATGA
CTGAAACTTACCTTACTGTGAAACACTGTGAACTCTTATAATGTAAGTATTTTTCACTTACAGG
AATAGAAAAATAAAAGTTGGCTCTACTAATGAATACTTGTTCCTGGGGCAGCAACTCAGAAAAC
TGAAGTATAAATCTTCAGTCAAGATACAGTAGTATTAATTTAGGGAATGATTCTATCCTAAGCT
TTGAAGTAGAATTATAATAACAAAACATTTAAGTTCAATATTTTCCCAGTACACAAAACACTAG
AGGTAGAAACTGGAGAGACGAAGTCCTTCCTCTACTGGAACCTGCTTTAGAGCTAGGTACTGGG
TTTTGCTTCTCTTCCACATTAAAGTTTATTGGGACCTAAAGTGTGAAAATTTTACTAAGCAAAA
TCACCTAATTGTGTATTGTACCCAAAGAAATAAACTTTAAAAGGTGATTCCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_031439	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA19001	(Get FASTA)	NCBI Sequence Viewer
	AAI16416	(Get FASTA)	NCBI Sequence Viewer
	AAI16417	(Get FASTA)	NCBI Sequence Viewer
	BAC32938	(Get FASTA)	NCBI Sequence Viewer
	BAC36732	(Get FASTA)	NCBI Sequence Viewer
	Q60614	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_031439 ⟸ NM_007413

- UniProtKB:

Q60614 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFAIPFA
ITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGTRARGIIAV
LWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMSYMVYFNFFGCVL
PPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAINCI
TLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYSFHKIISRYVLCQAETKGGSG
QAGAQSTLSLGL

hide sequence

RefSeq Acc Id:

ENSMUSP00000018644 ⟸ ENSMUST00000018644

Protein Domains

G_PROTEIN_RECEP_F1_2

Promoters

RGD ID:

6820291

Promoter ID:

MM_KWN:7807

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Lung

Transcripts:

OTTMUST00000013020

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	62,062,301 - 62,062,801 (+)	MPROMDB

RGD ID:

8674962

Promoter ID:

EPDNEW_M15511

Type:

initiation region

Name:

Adora2b_1

Description:

Mus musculus adenosine A2b receptor , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	62,248,984 - 62,249,044	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:99403	AgrOrtholog
Ensembl Genes	ENSMUSG00000018500	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000018644	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000018644	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	Adeno_A2B_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Adenosn_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:11541	UniProtKB/Swiss-Prot
MGD	MGI:99403	ENTREZGENE
NCBI Gene	11541	ENTREZGENE
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	ADORA2B	RGD
PhenoGen	Adora2b	PhenoGen
PRINTS	ADENOSINA2BR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADENOSINER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	AA2BR_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8BK41_MOUSE	UniProtKB/TrEMBL
UniProt Secondary	Q8BXI2	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB