Qrfpr (pyroglutamylated RFamide peptide receptor)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Qrfpr (pyroglutamylated RFamide peptide receptor) Rattus norvegicus

Analyze

Symbol:

Qrfpr

Name:

pyroglutamylated RFamide peptide receptor

RGD ID:

728380

Description:

Predicted to enable G protein-coupled receptor activity and peptide binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway and cellular response to hormone stimulus. Predicted to be located in non-motile cilium. Orthologous to human QRFPR (pyroglutamylated RFamide peptide receptor); INTERACTS WITH 6-propyl-2-thiouracil; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AQ27; G protein-coupled receptor 103; G-protein coupled receptor 103; Gpr103; orexigenic neuropeptide QRFP receptor; pyroglutamylated RF-amide peptide receptor; QRFP receptor; SP9155

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	119,053,083 - 119,096,864 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	119,053,511 - 119,096,792 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	125,606,352 - 125,649,723 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	123,719,044 - 123,762,423 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	118,347,801 - 118,391,177 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	122,891,321 - 122,949,241 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	122,891,321 - 122,949,241 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	142,517,181 - 142,568,697 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	122,677,072 - 122,719,991 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	122,622,033 - 122,664,953 (-)	NCBI
Celera	2	114,013,952 - 114,057,159 (-)	NCBI		Celera
Cytogenetic Map	2	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bone structure disease (ISS)

genetic disease (ISO)

neurodevelopmental disorder with hearing loss, seizures, and brain abnormalities (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

6-propyl-2-thiouracil (EXP)

amphetamine (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bromobenzene (EXP)

caffeine (ISO)

chloropicrin (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

dimethylarsinic acid (ISO)

dorsomorphin (ISO)

fluoxetine (EXP)

fonofos (ISO)

methylarsonic acid (ISO)

Muraglitazar (EXP)

N,N-diethyl-m-toluamide (EXP)

parathion (ISO)

PCB138 (ISO)

permethrin (EXP)

phenylmercury acetate (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

terbufos (ISO)

Tesaglitazar (EXP)

triclosan (ISO)

triptonide (ISO)

troglitazone (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hormone stimulus (IBA)

G protein-coupled receptor signaling pathway (IBA,ISO,ISS)

neuropeptide signaling pathway (IEA)

Cellular Component

non-motile cilium (ISO)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (ISO,ISS)

neuropeptide Y receptor activity (IEA)

peptide binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A new peptidic ligand and its receptor regulating adrenal function in rats.	Fukusumi S, etal., J Biol Chem 2003 Nov 21;278(47):46387-95. Epub 2003 Sep 05.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12714592	PMID:16648250	PMID:16996040	PMID:17534937	PMID:24316073	PMID:25041985	PMID:25895849

Genomics

Comparative Map Data

Qrfpr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	119,053,083 - 119,096,864 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	119,053,511 - 119,096,792 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	125,606,352 - 125,649,723 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	123,719,044 - 123,762,423 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	118,347,801 - 118,391,177 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	122,891,321 - 122,949,241 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	122,891,321 - 122,949,241 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	142,517,181 - 142,568,697 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	122,677,072 - 122,719,991 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	122,622,033 - 122,664,953 (-)	NCBI
Celera	2	114,013,952 - 114,057,159 (-)	NCBI		Celera
Cytogenetic Map	2	q25	NCBI

QRFPR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	121,328,642 - 121,381,018 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	121,328,642 - 121,381,059 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	122,249,797 - 122,302,173 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	122,469,247 - 122,521,631 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	122,608,073 - 122,659,407	NCBI
Celera	4	119,634,941 - 119,687,269 (-)	NCBI		Celera
Cytogenetic Map	4	q27	NCBI
HuRef	4	117,976,714 - 118,029,012 (-)	NCBI		HuRef
CHM1_1	4	122,226,355 - 122,271,006 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	124,632,974 - 124,685,273 (-)	NCBI		T2T-CHM13v2.0

Qrfpr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	36,233,575 - 36,276,462 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	36,233,573 - 36,276,462 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	36,179,426 - 36,222,275 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	36,179,424 - 36,222,313 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	36,078,348 - 36,121,197 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	36,370,975 - 36,413,824 (-)	NCBI		MGSCv36	mm8
Celera	3	36,062,081 - 36,104,668 (-)	NCBI		Celera
Cytogenetic Map	3	B	NCBI
cM Map	3	17.41	NCBI

Qrfpr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	19,238,448 - 19,290,657 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955428	19,238,479 - 19,290,510 (+)	NCBI	ChiLan1.0	ChiLan1.0

QRFPR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	119,401,416 - 119,455,948 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	113,537,723 - 113,591,507 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	124,676,059 - 124,729,754 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	124,676,059 - 124,729,754 (-)	Ensembl	panpan1.1		panPan2

QRFPR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	18,717,060 - 18,769,733 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	18,717,339 - 18,767,061 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	18,940,022 - 18,993,469 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	18,843,015 - 18,894,469 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	18,843,251 - 18,894,525 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	18,803,353 - 18,856,710 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	19,074,287 - 19,127,802 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	19,553,129 - 19,603,173 (+)	NCBI		UU_Cfam_GSD_1.0

Qrfpr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	66,283,441 - 66,321,512 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936662	797,281 - 825,194 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936662	797,533 - 861,989 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

QRFPR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	102,745,450 - 102,794,896 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	102,745,001 - 102,791,366 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	110,011,558 - 110,021,885 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

QRFPR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	68,617,661 - 68,672,874 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	68,615,807 - 68,672,477 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	47,581,339 - 47,639,032 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Qrfpr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624777	1,419,637 - 1,484,608 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624777	1,420,050 - 1,484,518 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Qrfpr
214 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	10
Count of miRNA genes:	10
Interacting mature miRNAs:	10
Transcripts:	ENSRNOT00000039615
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	112103657	148076632	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1354594	Despr10	Despair related QTL 10		0.00000249	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	114654253	159654253	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	143657569	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	143657569	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
5135226	Leukc2	Leukocyte quantity QTL 2			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	2	118111229	149559726	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	118111229	157142209	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	118189491	163189491	Rat

Markers in Region

RH138050

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	119,055,188 - 119,055,395 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	122,892,999 - 122,893,205	NCBI	Rnor6.0
Rnor_5.0	2	142,518,859 - 142,519,065	UniSTS	Rnor5.0
RGSC_v3.4	2	122,678,750 - 122,678,956	UniSTS	RGSC3.4
Celera	2	114,015,630 - 114,015,836	UniSTS
RH 3.4 Map	2	678.5	UniSTS
Cytogenetic Map	2	q25	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			8								1
Low					9				50	25	11	9
Below cutoff	1	6	11	4	9	4	3	3	20	8	20	2	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB109630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000039615 ⟹ ENSRNOP00000035152

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	119,053,511 - 119,096,792 (-)	Ensembl
Rnor_6.0 Ensembl	2	122,891,321 - 122,949,241 (-)	Ensembl

RefSeq Acc Id:

NM_198199 ⟹ NP_937842

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	119,053,083 - 119,096,864 (-)	NCBI
Rnor_6.0	2	122,891,321 - 122,949,241 (-)	NCBI
Rnor_5.0	2	142,517,181 - 142,568,697 (-)	NCBI
RGSC_v3.4	2	122,677,072 - 122,719,991 (-)	RGD
Celera	2	114,013,952 - 114,057,159 (-)	RGD

Sequence:

show sequence

ATGCAGGCGCTCAACATCACCGCGGAGCAGTTCTCCCGGCTGCTGAGCGCGCACAACCTGACTC
GGGAGCAGTTCATTCATCGCTATGGGCTGAGACCGCTGGTCTACACTCCGGAGCTGCCCGCGCG
TGCTAAAGTGGCCTTTGCGCTGGCAGGAGCACTCATTTTTGCCCTGGCGCTCTTCGGCAACTCT
CTGGTCATCTATGTGGTGACCCGCAGCAAGGCCATGCGCACCGTCACCAACATCTTCATCTGCT
CTCTGGCACTCAGTGATCTGCTCATTGCCTTCTTCTGCATCCCCGTCACGATGCTCCAGAACAT
CTCCGACAAGTGGCTGGGTGGTGCCTTCATCTGCAAGATGGTACCCTTTGTCCAGTCCACGGCC
GTCGTGACAGAAATCCTCACCATGACCTGCATCGCTGTTGAGAGGCACCAAGGACTTGTCCATC
CTTTTAAAATGAAGTGGCAGTACACCACCCGAAGGGCCTTCACGATCTTGGGCGTGGTCTGGTT
GGCGGCCATCATCGTAGGATCACCCATGTGGCACGTGCAACGCCTTGAGATTAAGTATGACTTC
CTCTATGAAAAAGAACACATCTGCTGCTTGGAAGAATGGGCCAGCCCCGTGCACCAGAGAATCT
ACAGCACCTTCATTCTCGTCATCCTCTTCCTCCTGCCTCTTGTGGTAATGCTAGTCCTCTATAG
CAAGATTGGCTATGAACTGTGGATCAAGAAGAGAGTGGGAGACAGTTCAGCGCTTCAAACTATC
CACGGGAAAGAAATGTCCAAAATAGCCAGGAAGAAGAAGCGGGCTGTCATTATGATGGTGACTG
TGGTGGCTCTCTTTGCTGCATGCTGGGCACCTTTCCACGTTGTTCACATGATGGTTGAGTACAG
TAATTTTGAAAAAGAATATGATGATGTCACAATCAAGATGGTCTTTGCTGTCGCGCAGACAATT
GGCTTTTTCAACTCCATCTGTAATCCCTTTGTGTATGCGTTTATGAATGAAAACTTCAAAAAGA
ATTTTCTGTCTGCTGTTTGTTATTGCATAGTGAAAGAATCCTCCTCCCCAGCACGGAAGCCTGG
GAATTCTGGAATATCAATGATGCAGAAGAGAGCAAAGTTATCTCGACCACAGCGTCCAGTGGAA
GAAACCAAAGGAGACACATTCAGTGATGCCAGCATTGATGTCAAATTGTGCGAGCAGCCGCGGG
AGAAAAGACAACTCAAGAGACAGCTAGCCTTCTTCAGTTCTGAACTTTCTGAAAACTCTACTTT
TGGTAGTGGCCATGAACTGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_937842	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC98939	(Get FASTA)	NCBI Sequence Viewer
	EDM01273	(Get FASTA)	NCBI Sequence Viewer
	EDM01274	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035152
GenBank Protein	P83858	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_937842 ⟸ NM_198199

- UniProtKB:

P83858 (UniProtKB/Swiss-Prot), A6IHX5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKVAFALAGALIFALALFGNS
LVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKMVPFVQSTA
VVTEILTMTCIAVERHQGLVHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPMWHVQRLEIKYDF
LYEKEHICCLEEWASPVHQRIYSTFILVILFLLPLVVMLVLYSKIGYELWIKKRVGDSSALQTI
HGKEMSKIARKKKRAVIMMVTVVALFAACWAPFHVVHMMVEYSNFEKEYDDVTIKMVFAVAQTI
GFFNSICNPFVYAFMNENFKKNFLSAVCYCIVKESSSPARKPGNSGISMMQKRAKLSRPQRPVE
ETKGDTFSDASIDVKLCEQPREKRQLKRQLAFFSSELSENSTFGSGHEL

hide sequence

RefSeq Acc Id:

ENSRNOP00000035152 ⟸ ENSRNOT00000039615

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P83858-F1-model_v2	AlphaFold	P83858	1-433	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:728380	AgrOrtholog
BioCyc Gene	G2FUF-53321	BioCyc
Ensembl Genes	ENSRNOG00000014414	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000039615	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	NPY_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:310327	UniProtKB/Swiss-Prot
NCBI Gene	310327	ENTREZGENE
PANTHER	G_PROTEIN_RECEP_F1_2 DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROPEPTIDE Y RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Qrfpr	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NRPEPTIDEYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014414	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IHX5	ENTREZGENE, UniProtKB/TrEMBL
	P83858	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-01-05	Qrfpr	pyroglutamylated RFamide peptide receptor	Gpr103	G protein-coupled receptor 103	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Gpr103	G protein-coupled receptor 103			Symbol and Name status set to approved	1299863	APPROVED
2005-09-30	Gpr103				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	highly expressed in adrenal gland	728128

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI