Zar1 (zygote arrest 1) - Rat Genome Database

Name: Zar1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Zar1 (zygote arrest 1) Rattus norvegicus

Analyze

Symbol:

Zar1

Name:

zygote arrest 1

RGD ID:

727972

Description:

Predicted to enable several functions, including RNA sequestering activity; mRNA 3'-UTR binding activity; and molecular condensate scaffold activity. Predicted to be involved in several processes, including oocyte maturation; post-transcriptional regulation of gene expression; and translation. Predicted to be located in cytoplasmic ribonucleoprotein granule. Predicted to be active in cytoplasm and intracellular non-membrane-bounded organelle. Orthologous to human ZAR1 (zygote arrest 1); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

oocyte-specific maternal effect factor; zygote arrest protein 1

RGD Orthologs

Human

Mouse

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZAR1 (zygote arrest 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Zar1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZAR1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZAR1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zar1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZAR1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZAR1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zar1 (zygote arrest 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ZAR1 (zygote arrest 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zar1 (zygote arrest 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zar1 (zygote arrest 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zar2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zar1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	35,193,446 - 35,197,382 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	35,193,446 - 35,197,382 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	35,557,323 - 35,561,262 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	14	36,862,080 - 36,866,019 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	14	35,350,406 - 35,354,345 (-)	NCBI	Rnor_WKY
Rnor_6.0	14	37,757,579 - 37,764,389 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	37,759,776 - 37,763,712 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	37,570,281 - 37,574,217 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	37,598,421 - 37,602,357 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	37,600,855 - 37,604,792 (-)	NCBI
Celera	14	34,448,509 - 34,452,445 (-)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-Tetrachlorodibenzofuran (EXP)

6-propyl-2-thiouracil (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

methotrexate (ISO)

pirinixic acid (ISO)

silicon dioxide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mRNA stabilization (ISO,ISS)

negative regulation of translation (ISO,ISS)

non-membrane-bounded organelle assembly (ISO,ISS)

oocyte maturation (ISO,ISS)

translation (IBA)

Cellular Component

cytoplasm (IBA,ISO)

cytoplasmic ribonucleoprotein granule (IEA)

intracellular non-membrane-bounded organelle (ISO,ISS)

Molecular Function

metal ion binding (IEA)

molecular condensate scaffold activity (ISO,ISS)

mRNA 3'-UTR binding (ISO,ISS)

protein binding (ISO)

RNA sequestering activity (ISO,ISS)

translation regulator activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Zygote arrest 1 (Zar1) is an evolutionarily conserved gene expressed in vertebrate ovaries.	Wu X, etal., Biol Reprod 2003 Sep;69(3):861-7. Epub 2003 May 28.

Additional References at PubMed

PMID:20014101

Genomics

Comparative Map Data

Zar1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	35,193,446 - 35,197,382 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	35,193,446 - 35,197,382 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	35,557,323 - 35,561,262 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	14	36,862,080 - 36,866,019 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	14	35,350,406 - 35,354,345 (-)	NCBI	Rnor_WKY
Rnor_6.0	14	37,757,579 - 37,764,389 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	37,759,776 - 37,763,712 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	37,570,281 - 37,574,217 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	37,598,421 - 37,602,357 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	37,600,855 - 37,604,792 (-)	NCBI
Celera	14	34,448,509 - 34,452,445 (-)	NCBI		Celera
Cytogenetic Map	14	p11	NCBI

ZAR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	48,490,252 - 48,497,635 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	48,490,252 - 48,494,389 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	48,492,269 - 48,496,406 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	48,187,066 - 48,191,181 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	48,333,236 - 48,337,348	NCBI
Celera	4	48,941,100 - 48,945,109 (+)	NCBI		Celera
Cytogenetic Map	4	p11	NCBI
HuRef	4	47,812,310 - 47,816,447 (+)	NCBI		HuRef
CHM1_1	4	48,491,424 - 48,495,561 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	48,457,286 - 48,465,127 (+)	NCBI		T2T-CHM13v2.0

Zar1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	72,734,456 - 72,738,707 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	72,734,149 - 72,738,597 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	72,577,113 - 72,581,361 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	72,576,806 - 72,581,254 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	72,968,353 - 72,972,323 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	72,856,249 - 72,860,219 (-)	NCBI		MGSCv36	mm8
Celera	5	69,825,570 - 69,829,543 (-)	NCBI		Celera
Cytogenetic Map	5	C3.2	NCBI

ZAR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	79,628,838 - 79,636,039 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	73,655,842 - 73,663,037 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	84,386,344 - 84,390,005 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

ZAR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	44,301,690 - 44,307,188 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	44,252,794 - 44,257,490 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	44,903,436 - 44,907,993 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	44,904,428 - 44,907,984 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	44,577,962 - 44,582,609 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	44,114,292 - 44,117,682 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	44,993,008 - 44,997,709 (+)	NCBI		UU_Cfam_GSD_1.0

Zar1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	31,781,714 - 31,795,486 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	14,503,197 - 14,507,183 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936482	14,502,680 - 14,510,023 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZAR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	38,386,643 - 38,391,611 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	38,386,520 - 38,391,618 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	40,420,104 - 40,425,070 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZAR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	1,745,297 - 1,762,724 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	1,758,050 - 1,762,016 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	47,756,823 - 47,765,472 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zar1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624761	18,485,440 - 18,488,882 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624761	18,485,286 - 18,488,988 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zar1
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	112
Count of miRNA genes:	92
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000030610
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2324617	Coatc2	Coat color QTL 2		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	14	30767025	39153750	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	30883777	68757901	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium											4
Low									41		7
Below cutoff	1	3	15	2	14	2	4	4	27	4	18	7	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_181385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY283175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000030610 ⟹ ENSRNOP00000032032

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	35,193,446 - 35,197,382 (-)	Ensembl
Rnor_6.0 Ensembl	14	37,759,776 - 37,763,712 (-)	Ensembl

RefSeq Acc Id:

NM_181385 ⟹ NP_852050

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	35,193,446 - 35,197,382 (-)	NCBI
Rnor_6.0	14	37,759,776 - 37,763,712 (-)	NCBI
Rnor_5.0	14	37,570,281 - 37,574,217 (-)	NCBI
RGSC_v3.4	14	37,598,421 - 37,602,357 (-)	RGD
Celera	14	34,448,509 - 34,452,445 (-)	RGD

Sequence:

show sequence

TGGGCCGGCGAGGCGCGGGACGCACCCATGTTCCCGGCGAGCACGCCCCACCCATGCCCGCATC
CTTACCCGCCCACGGCAGCCAAAGCCGGGGATGGCTGGAGGTTTGGAGCCAGGGGCTGCAGGCC
CGAGCCCCCCTCCTTCCTCCCCGGCTACAGACAGCTCATGGCCGCGGAGTACTTTGACAGCTAT
CAGCGAGCGCAGCTCATGGCCTTGCTGTCGCGAATGGGTCCCCGGCCGGTCAGCAGCCGCGACG
CTGCGGTGCAGGTGAACCCGCGCCGCGATGCCTCGGTGCAGTGTTCGCTCGGGCGCCGCACACT
GCAGCCTGGACGGCGCCGAGCCAGCCCCGACGCCCGGCCTGGTTCCTGCCAACCCCGCAGCCCC
GCCAGGGCCGGGAGACCCCCGCGATCCTGGCGCACCGTCGCCCTGTACTCGCCCGTGACCTTCG
GTGGCCTCTCCTCCTCGCTGGAGGTTGCGGGGGACAGGCAGACGCCCACGAAGGGAGAGGGGAG
ACCGGCACCCACGGGGACCCGGGAACCCGAGCCGGGAGAGGTGGCAGTGATGAAAGCAGTCCCC
CAGCCGCAGAGCGAGGAGGGCGACGTCCAGGCTGAAGGGCAGGATGGGCAGGAGCAGCCACCGC
GGGAGGACCCGGACAGTGTGGCGGCGATGCAGTCTGAGCCCGGGAGTGAGGAGCCACCTCCTGC
TGTCGAGATGGCTCAGGACCCCAGTGACGTGGCTGCCTCTAGAGACCGGGCCTCCCCACAGAGC
ACTGAGCAGGACAAGGAGCGCCTGCGTTTCCAGTTCTTAGAGCAGAAGTACGGCTACTATCACT
GCAAAGACTGCAACATCCGGTGGGAGAGCGCCTATGTGTGGTGTGTGCAGGGCACCAGCAAGGT
GTACTTCAAACAGTTCTGCCGCGTGTGTGAGAAGTCCTACAACCCATACCGAGTGGAGGATATC
ACCTGCCAAAGTTGTAAAAGGACTAGATGTGCCTGCCCGGTCAGACTTCGCCACGTGGACCCTA
AACGCCCCCATCGTCAAGACTTGTGTGGGAGATGCAAGGACAAACGCCTGTCCTGTGACAGCAC
CTTCAGCTTCAAATATATCATTTAGAGAGAGTTAAAAATGGTTCTGCTAAATGGATCGGACAAG
TGAGCCTTCTCCCACGCCCCTCTCCCCTCTCCACCTCTCCCTTCTCAAAATACTTCATGAAAGG
CAGTGTACTTTAATATAAAGCCTGCGAATAAAAGGGGTTGCAAACAGTTTGGGGCTTTATCCAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_852050	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP37037	(Get FASTA)	NCBI Sequence Viewer
	EDL89977	(Get FASTA)	NCBI Sequence Viewer
	Q7TSX9	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_852050 ⟸ NM_181385

- UniProtKB:

Q7TSX9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MFPASTPHPCPHPYPPTAAKAGDGWRFGARGCRPEPPSFLPGYRQLMAAEYFDSYQRAQLMALL
SRMGPRPVSSRDAAVQVNPRRDASVQCSLGRRTLQPGRRRASPDARPGSCQPRSPARAGRPPRS
WRTVALYSPVTFGGLSSSLEVAGDRQTPTKGEGRPAPTGTREPEPGEVAVMKAVPQPQSEEGDV
QAEGQDGQEQPPREDPDSVAAMQSEPGSEEPPPAVEMAQDPSDVAASRDRASPQSTEQDKERLR
FQFLEQKYGYYHCKDCNIRWESAYVWCVQGTSKVYFKQFCRVCEKSYNPYRVEDITCQSCKRTR
CACPVRLRHVDPKRPHRQDLCGRCKDKRLSCDSTFSFKYII

hide sequence

RefSeq Acc Id:

ENSRNOP00000032032 ⟸ ENSRNOT00000030610

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TSX9-F1-model_v2	AlphaFold	Q7TSX9	1-361	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727972	AgrOrtholog
BioCyc Gene	G2FUF-15861	BioCyc
Ensembl Genes	ENSRNOG00000026150	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000032032	ENTREZGENE
	ENSRNOP00000032032.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000030610	ENTREZGENE
	ENSRNOT00000030610.2	UniProtKB/Swiss-Prot
InterPro	Zar1	UniProtKB/Swiss-Prot
	Znf-3CxxC	UniProtKB/Swiss-Prot
KEGG Report	rno:353228	UniProtKB/Swiss-Prot
NCBI Gene	353228	ENTREZGENE
PANTHER	PTHR31054	UniProtKB/Swiss-Prot
	ZYGOTE ARREST PROTEIN 1	UniProtKB/Swiss-Prot
Pfam	zf-3CxxC	UniProtKB/Swiss-Prot
PhenoGen	Zar1	PhenoGen
SMART	zf-3CxxC	UniProtKB/Swiss-Prot
UniProt	Q7TSX9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Zar1	zygote arrest 1			Symbol and Name status set to approved	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_evolution	C-terminal region evolutionarily conserved throughout vertebrates	1299617

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar