Defa5 (defensin alpha 5) - Rat Genome Database

Name: Defa5
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Defa5 (defensin alpha 5) Rattus norvegicus

Analyze

Symbol:

Defa5

Name:

defensin alpha 5

RGD ID:

727951

Description:

Predicted to enable protein homodimerization activity. Predicted to be involved in several processes, including defense response to other organism; positive regulation of interleukin-8 production; and protein homotetramerization. Predicted to be located in midbody and secretory granule. Predicted to be active in extracellular space. Orthologous to several human genes including DEFA5 (defensin alpha 5); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; acetylsalicylic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-defensin 5, Paneth cell-specific; Defa; defensin NP-2; defensin NP-2 precursor; defensin, alpha 5, Paneth cell-specific; LOC286995; neutrophil antibiotic peptide NP-1; neutrophil antibiotic peptide NP-2; neutrophil defensin 1; neutrophil defensin 2; ratNP-1; ratNP-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DEFA5 (defensin alpha 5)	HGNC	EggNOG, Ensembl, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):	Defa21 (defensin, alpha, 21)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100991118 (defensin alpha 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DEFA5 (defensin alpha 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DEFA4 (defensin alpha 4)	HGNC	Ensembl, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):	DEFA6 (defensin alpha 6)	HGNC	Ensembl, Panther, PhylomeDB, Treefam
Homo sapiens (human):	DEFA3 (defensin alpha 3)	HGNC	Ensembl, Panther, PhylomeDB, Treefam
Homo sapiens (human):	DEFA1 (defensin alpha 1)	HGNC	EggNOG, Ensembl, Panther, Treefam
Homo sapiens (human):	DEFA1B (defensin alpha 1B)	HGNC	Ensembl, PhylomeDB, Treefam
Homo sapiens (human):	SLC1A4 (solute carrier family 1 member 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DEFA3 (defensin alpha 3)	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Homo sapiens (human):	DEFA5 (defensin alpha 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	DEFA1 (defensin alpha 1)	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Homo sapiens (human):	DEFA1B (defensin alpha 1B)	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)

Related Pseudogenes:

Defa5-ps2

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	77,044,994 - 77,047,318 (-)	NCBI		GRCr8
mRatBN7.2	16	70,342,530 - 70,344,854 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	70,342,530 - 70,344,836 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	75,616,245 - 75,618,551 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	79,069,107 - 79,071,419 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	74,318,539 - 74,320,851 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	75,338,050 - 75,340,401 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	75,338,052 - 75,340,360 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	74,952,566 - 74,954,917 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	75,024,375 - 75,026,675 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	75,024,639 - 75,026,940 (-)	NCBI
Celera	16	68,215,238 - 68,217,544 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Adenomatous Polyps (ISO)

Colonic Neoplasms (ISO)

IgA glomerulonephritis (ISO)

inflammatory bowel disease (ISO)

Peutz-Jeghers syndrome (ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

acetylsalicylic acid (EXP)

acrylamide (EXP)

alachlor (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

benzo[a]pyrene (ISO)

beta-hexachlorocyclohexane (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

cadmium dichloride (EXP)

chlordecone (ISO)

chlorothalonil (ISO)

chromium(6+) (ISO)

clofibrate (ISO)

clothianidin (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

dimethylarsinic acid (ISO)

entinostat (ISO)

iron atom (EXP)

iron(0) (EXP)

methylarsonic acid (ISO)

methylmercury chloride (EXP)

nitrofen (EXP)

paracetamol (ISO)

pirinixic acid (ISO)

procymidone (ISO)

Prothioconazole-desthio (ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

testosterone (EXP)

Tributyltin oxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antibacterial humoral response (IBA)

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,ISO)

cellular response to lipopolysaccharide (IBA)

defense response to bacterium (TAS)

defense response to fungus (IEA)

defense response to Gram-negative bacterium (IBA,ISO)

defense response to Gram-positive bacterium (IBA,ISO)

disruption of plasma membrane integrity in another organism (IBA)

innate immune response (ISO)

innate immune response in mucosa (IBA)

killing by host of symbiont cells (ISO)

killing of cells of another organism (IEA)

positive regulation of interleukin-8 production (ISO)

positive regulation of membrane permeability (ISO)

protein homotetramerization (ISO)

Cellular Component

extracellular space (IBA,ISO)

intracellular membrane-bounded organelle (ISO)

midbody (ISO)

secretory granule (ISO)

Molecular Function

protein binding (ISO)

protein homodimerization activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Rat neutrophil defensins. Precursor structures and expression during neutrophilic myelopoiesis.	Yount NY, etal., J Immunol 1995 Nov 1;155(9):4476-84.

Additional References at PubMed

PMID:2254017	PMID:2543629	PMID:9169780	PMID:15616305	PMID:17088326	PMID:21861459	PMID:30480410

Genomics

Comparative Map Data

Defa5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	77,044,994 - 77,047,318 (-)	NCBI		GRCr8
mRatBN7.2	16	70,342,530 - 70,344,854 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	70,342,530 - 70,344,836 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	75,616,245 - 75,618,551 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	79,069,107 - 79,071,419 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	74,318,539 - 74,320,851 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	75,338,050 - 75,340,401 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	75,338,052 - 75,340,360 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	74,952,566 - 74,954,917 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	75,024,375 - 75,026,675 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	75,024,639 - 75,026,940 (-)	NCBI
Celera	16	68,215,238 - 68,217,544 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

DEFA5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	7,055,304 - 7,056,739 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	7,055,304 - 7,056,739 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	6,912,826 - 6,914,261 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	6,900,239 - 6,901,669 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	6,900,238 - 6,901,669	NCBI
Celera	8	6,879,990 - 6,881,416 (-)	NCBI		Celera
Cytogenetic Map	8	p23.1	NCBI
HuRef	8	6,654,020 - 6,655,446 (-)	NCBI		HuRef
CHM1_1	8	7,001,371 - 7,002,801 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	6,809,926 - 6,811,358 (-)	NCBI		T2T-CHM13v2.0

Defa21
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	21,515,561 - 21,516,533 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	21,515,561 - 21,516,532 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	21,025,545 - 21,026,517 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	21,025,545 - 21,026,516 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	22,165,224 - 22,166,196 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	22,520,296 - 22,521,268 (+)	NCBI		MGSCv36	mm8
Celera	8	22,918,740 - 22,919,712 (+)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	10.35	NCBI

LOC100991118
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	21,915,839 - 21,917,139 (-)	NCBI		NHGRI_mPanPan1-v2
Mhudiblu_PPA_v0	8	264,298 - 265,962 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

DEFA5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023669959	743 - 2,256 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Defa5
7 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	9
Count of miRNA genes:	9
Interacting mature miRNAs:	9
Transcripts:	ENSRNOT00000018501
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat
1298527	Arunc2	Aerobic running capacity QTL 2	2.9		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	68532716	75029966	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	19	37	59	61	44	25	44	120	49	32	23	27	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006253367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U16685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U16686	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018501 ⟹ ENSRNOP00000018501

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	70,342,530 - 70,344,836 (-)	Ensembl
Rnor_6.0 Ensembl	16	75,338,052 - 75,340,360 (-)	Ensembl

RefSeq Acc Id:

NM_173329 ⟹ NP_775451

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	77,044,994 - 77,047,318 (-)	NCBI
mRatBN7.2	16	70,342,530 - 70,344,854 (-)	NCBI
Rnor_6.0	16	75,338,051 - 75,340,357 (-)	NCBI
Rnor_5.0	16	74,952,566 - 74,954,917 (-)	NCBI
RGSC_v3.4	16	75,024,375 - 75,026,675 (-)	RGD
Celera	16	68,215,238 - 68,217,544 (-)	NCBI

Sequence:

show sequence

CAGGTCTGGACAGAAGAGTGCTGTCTCTCTTGCTCTGCTCTCCGTGATTACCCTCAAAGATCTG
AGACCCACAGCCATGAGGACGCTCACTCTGCTTACCGCCCTTCTCCTGCTGGCCCTCCACACCC
AGGCAAAATCTCCCCAAGGAACCGCTGAGGAGGCTCCAGACCAGGAGCAGCTGGTCATGGAGGA
CCAGGATATTTCCATATCCTTTGGAGGGGATAAAGGCACTGCTCTCCAAGATGCAGATGTGAAG
GCAGGCGTGACCTGCTATTGCAGAAGCACACGCTGTGGTTTTAGAGAACGGCTCTCTGGGGCCT
GTGGTTACCGTGGCCGCATCTACAGACTGTGCTGCCGCTGAGCACTCCGACCAAGAAGAATCCA
TTTGTCAAATGATCTGAGATCTTGAACGAGACTGCTATTTGTCAGATGTTATGTCCTTGAGTTT
CCTCTTCCTTTACACTCAAATAAAGTTCTTACAGCAAGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_775451	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA91973	(Get FASTA)	NCBI Sequence Viewer
	AAA91974	(Get FASTA)	NCBI Sequence Viewer
	EDM08976	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018501.1
	ENSRNOP00055011229
	ENSRNOP00060035846
	ENSRNOP00065010774
GenBank Protein	Q62715	(Get FASTA)	NCBI Sequence Viewer
	Q62716	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_775451 ⟸ NM_173329
- Peptide Label:	precursor
- UniProtKB:	Q62716 (UniProtKB/Swiss-Prot), Q62715 (UniProtKB/Swiss-Prot), A6IW96 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRTLTLLTALLLLALHTQAKSPQGTAEEAPDQEQLVMEDQDISISFGGDKGTALQDADVKAGVT CYCRSTRCGFRERLSGACGYRGRIYRLCCR hide sequence

Ensembl Acc Id:

ENSRNOP00000018501 ⟸ ENSRNOT00000018501

Protein Domains

Mammalian defensins

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62715-F1-model_v2	AlphaFold	Q62715	1-94	view protein structure
AF-Q62716-F1-model_v2	AlphaFold	Q62716	1-94	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700202

Promoter ID:

EPDNEW_R10726

Type:

single initiation site

Name:

Defa5_1

Description:

defensin alpha 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	75,340,375 - 75,340,435	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727951	AgrOrtholog
BioCyc Gene	G2FUF-10838	BioCyc
Ensembl Genes	ENSRNOG00000030093	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055008287	UniProtKB/Swiss-Prot
	ENSRNOG00060025023	UniProtKB/Swiss-Prot
	ENSRNOG00065009001	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018501.4	UniProtKB/Swiss-Prot
	ENSRNOT00055014006	UniProtKB/Swiss-Prot
	ENSRNOT00060043291	UniProtKB/Swiss-Prot
	ENSRNOT00065014378	UniProtKB/Swiss-Prot
InterPro	Alpha-defensin	UniProtKB/Swiss-Prot
	Alpha-defensin	UniProtKB/TrEMBL
	Alpha-defensin_C	UniProtKB/TrEMBL
	Alpha-defensin_N	UniProtKB/TrEMBL
	Alpha-defensin_pro	UniProtKB/Swiss-Prot
	Beta/alpha-defensin_C	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	Defensin_propep	UniProtKB/Swiss-Prot
KEGG Report	rno:286995	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	286995	ENTREZGENE
PANTHER	ALPHA-DEFENSIN 1	UniProtKB/TrEMBL
	DEFENSIN ALPHA 10-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11876	UniProtKB/Swiss-Prot
Pfam	Defensin_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Defensin_propep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Defa5	PhenoGen
PIRSF	Alpha-defensin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	DEFENSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000030093	RatGTEx
	ENSRNOG00055008287	RatGTEx
	ENSRNOG00060025023	RatGTEx
	ENSRNOG00065009001	RatGTEx
SMART	Defensin_propep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DEFSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Defensin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IW96	ENTREZGENE, UniProtKB/TrEMBL
	DEF1_RAT	UniProtKB/Swiss-Prot
	DEF2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q62716	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Defa5	defensin alpha 5	Defa5	defensin, alpha 5, Paneth cell-specific	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-01	Defa5	defensin, alpha 5, Paneth cell-specific	Defa	defensin, alpha 5, Paneth cell-specific	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Defa	defensin, alpha 5, Paneth cell-specific	LOC286995	defensin NP-2 precursor	Symbol and Name updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_protein	synthesized as precursor proteins, then processed to smaller polypeptide forms	1299571

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD