Scgb3a1 (secretoglobin, family 3A, member 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Scgb3a1 (secretoglobin, family 3A, member 1) Rattus norvegicus

Analyze

Symbol:

Scgb3a1

Name:

secretoglobin, family 3A, member 1

RGD ID:

727901

Description:

Predicted to be involved in positive regulation of myoblast fusion. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human SCGB3A1 (secretoglobin family 3A member 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Hin1; pneumo secretory protein 2; PnSP-2; Pnsp2; secretoglobin; secretoglobin family 3A member 1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	33,968,059 - 33,969,366 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	33,968,059 - 33,969,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	38,643,651 - 38,644,958 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,182,054 - 7,183,361 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	33,637,313 - 33,638,620 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	35,133,561 - 35,134,868 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	35,133,252 - 35,135,466 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	34,905,080 - 34,906,387 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	35,125,569 - 35,126,876 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	35,127,288 - 35,128,035 (+)	NCBI
Celera	10	33,324,580 - 33,325,887 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

endometriosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium dichloride (EXP)

calcium silicate (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

Cuprizon (EXP)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

doxorubicin (ISO)

Erionite (ISO)

fulvestrant (ISO)

genistein (EXP,ISO)

isoprenaline (ISO)

naphthalene (ISO)

nitrofen (EXP)

paracetamol (EXP)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (EXP)

sodium arsenite (ISO)

testosterone (EXP)

titanium dioxide (EXP,ISO)

tremolite asbestos (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of myoblast fusion (IBA,ISO)

Cellular Component

extracellular region (TAS)

extracellular space (IBA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	Secretoglobins SCGB3A1 and SCGB3A2 define secretory cell subsets in mouse and human airways.	Reynolds SD, etal., Am J Respir Crit Care Med 2002 Dec 1;166(11):1498-509. Epub 2002 Aug 1.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11481438	PMID:16502470	PMID:19199708	PMID:23844157

Genomics

Comparative Map Data

Scgb3a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	33,968,059 - 33,969,366 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	33,968,059 - 33,969,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	38,643,651 - 38,644,958 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,182,054 - 7,183,361 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	33,637,313 - 33,638,620 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	35,133,561 - 35,134,868 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	35,133,252 - 35,135,466 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	34,905,080 - 34,906,387 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	35,125,569 - 35,126,876 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	35,127,288 - 35,128,035 (+)	NCBI
Celera	10	33,324,580 - 33,325,887 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

SCGB3A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	180,590,105 - 180,591,499 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	180,590,105 - 180,591,499 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	180,017,105 - 180,018,499 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	179,949,711 - 179,951,093 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	179,949,711 - 179,951,093	NCBI
Celera	5	175,639,688 - 175,641,070 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	174,741,080 - 174,742,462 (-)	NCBI		HuRef
CHM1_1	5	179,449,540 - 179,450,922 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	181,145,993 - 181,147,387 (-)	NCBI		T2T-CHM13v2.0

Scgb3a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	49,554,422 - 49,555,945 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	49,554,437 - 49,555,945 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	49,663,595 - 49,665,118 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	49,663,610 - 49,665,118 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	49,477,112 - 49,478,620 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	49,507,033 - 49,508,541 (+)	NCBI		MGSCv36	mm8
Celera	11	54,225,407 - 54,226,915 (+)	NCBI		Celera
Cytogenetic Map	11	B1.2	NCBI
cM Map	11	29.75	NCBI

Scgb3a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	147,777 - 149,227 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	147,777 - 149,227 (+)	NCBI	ChiLan1.0	ChiLan1.0

SCGB3A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Mhudiblu_PPA_v0	5	175,792,429 - 175,797,122 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

Scgb3a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	119,092,049 - 119,093,637 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936739	300,579 - 303,414 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCGB3A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	78,125,825 - 78,127,793 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	78,125,874 - 78,127,791 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	79,514,776 - 79,560,816 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCGB3A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	82,315,106 - 82,317,600 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666075	13,735,739 - 13,737,333 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scgb3a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	43,195,143 - 43,196,568 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	43,195,131 - 43,196,655 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Scgb3a1
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	36
Count of miRNA genes:	34
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000051916
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	cortical volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum total immunoglobulin E level (CMO:0001542)	10	22918268	36400810	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	27957626	34490668	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat

Markers in Region

RH139977

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	33,968,918 - 33,969,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	35,134,421 - 35,134,970	NCBI	Rnor6.0
Rnor_5.0	10	34,905,940 - 34,906,489	UniSTS	Rnor5.0
RGSC_v3.4	10	35,126,429 - 35,126,978	UniSTS	RGSC3.4
Celera	10	33,325,440 - 33,325,989	UniSTS
RH 3.4 Map	10	366.4	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		4										10
Low	1	3	16	2	19	2	1	2	8	2	12	1	1
Below cutoff	2	16	11	9		9	7	8	3	7	7		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF436841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK000202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000051916 ⟹ ENSRNOP00000045446

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	33,968,059 - 33,969,366 (+)	Ensembl
Rnor_6.0 Ensembl	10	35,133,252 - 35,135,466 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113012 ⟹ ENSRNOP00000089765

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	33,968,482 - 33,969,476 (+)	Ensembl

RefSeq Acc Id:

NM_001013180 ⟹ NP_001013198

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	33,968,059 - 33,969,366 (+)	NCBI
Rnor_6.0	10	35,133,561 - 35,134,868 (+)	NCBI
Rnor_5.0	10	34,905,080 - 34,906,387 (+)	NCBI
RGSC_v3.4	10	35,125,569 - 35,126,876 (+)	RGD
Celera	10	33,324,580 - 33,325,887 (+)	RGD

Sequence:

show sequence

TCTCATTCCACCATGAAGCTCACCGCCATCTTTCTAGTGTTCTGTGTGGCTCTGCTCAGCGACT
CTGGCGTTGCTTTCTTCGTGGATTCACTGGCCAAGCCTGTGGTAGAACCCGTGGCTGCCCTTGC
TCCAGCTGCAGAGGCTGTGGCAGGGGCTGTGCCTAGCCTACCATTAAGCCACTTGGCCATCCTG
AGGTTCATCCTGGCCAGCCTGGGCATCCCATTGGATCCTCTCATAGATGGTTCCAGGAAGTGCG
TCACCGAGCTGGGCCCTGAGGCTGTAGGAGCTGTGAAGTCACTGCTGGGGGCCCTGACAACGTT
CGGTTGAGGTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013198	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ04483	(Get FASTA)	NCBI Sequence Viewer
	DAA00359	(Get FASTA)	NCBI Sequence Viewer
	EDM04227	(Get FASTA)	NCBI Sequence Viewer
	EDM04228	(Get FASTA)	NCBI Sequence Viewer
	EDM04229	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001013198 ⟸ NM_001013180
- Peptide Label:	precursor
- UniProtKB:	Q71MT8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLTAIFLVFCVALLSDSGVAFFVDSLAKPVVEPVAALAPAAEAVAGAVPSLPLSHLAILRFIL ASLGIPLDPLIDGSRKCVTELGPEAVGAVKSLLGALTTFG hide sequence

RefSeq Acc Id:

ENSRNOP00000045446 ⟸ ENSRNOT00000051916

RefSeq Acc Id:

ENSRNOP00000089765 ⟸ ENSRNOT00000113012

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PU36-F1-model_v2	AlphaFold	E9PU36	1-104	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697144

Promoter ID:

EPDNEW_R7669

Type:

single initiation site

Name:

Scgb3a1_1

Description:

secretoglobin, family 3A, member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	35,133,527 - 35,133,587	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727901	AgrOrtholog
BioCyc Gene	G2FUF-25280	BioCyc
Ensembl Genes	ENSRNOG00000002718	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000045446	ENTREZGENE
	ENSRNOP00000045446.2	UniProtKB/TrEMBL
	ENSRNOP00000089765.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000051916	ENTREZGENE
	ENSRNOT00000051916.4	UniProtKB/TrEMBL
	ENSRNOT00000113012.1	UniProtKB/TrEMBL
InterPro	Secretoglobin_3A	UniProtKB/TrEMBL
KEGG Report	rno:338418	UniProtKB/TrEMBL
NCBI Gene	338418	ENTREZGENE
PANTHER	PTHR34829	UniProtKB/TrEMBL
PhenoGen	Scgb3a1	PhenoGen
UniProt	A0A8I6AB14_RAT	UniProtKB/TrEMBL
	E9PU36_RAT	UniProtKB/TrEMBL
	Q71MT8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-11	Scgb3a1	secretoglobin, family 3A, member 1	Hin1	secretoglobin	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD