Gsdme (gasdermin E) - Rat Genome Database

Name: Gsdme
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gsdme (gasdermin E) Rattus norvegicus

Analyze

Symbol:

Gsdme

Name:

gasdermin E

RGD ID:

727871

Description:

Predicted to enable cardiolipin binding activity; phosphatidylinositol-4,5-bisphosphate binding activity; and wide pore channel activity. Predicted to be involved in several processes, including cellular response to tumor necrosis factor; granzyme-mediated programmed cell death signaling pathway; and positive regulation of intracellular signal transduction. Predicted to act upstream of or within inner ear auditory receptor cell differentiation. Predicted to be located in cytosol and plasma membrane. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 5 and sensorineural hearing loss. Orthologous to human GSDME (gasdermin E); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

deafness, autosomal dominant 5; deafness, autosomal dominant 5 (human); deafness, autosomal dominant 5 homolog; deafness, autosomal dominant 5 homolog (human); Dfna5; DFNA5, deafness associated tumor suppressor; Dfna5h; gasdermin-E; non-syndromic hearing impairment protein 5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GSDME (gasdermin E)	HGNC	Ensembl, HomoloGene, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gsdme (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gsdme (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GSDME (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GSDME (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gsdme (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GSDME (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GSDME (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gsdme (gasdermin E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GSDME (gasdermin E)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gsdme (gasdermin E)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gsdmea	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gsdmeb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	79,258,799 - 79,321,129 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	79,257,804 - 79,320,806 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	84,481,566 - 84,538,385 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	80,257,093 - 80,313,918 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	78,697,400 - 78,754,225 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	79,934,075 - 79,999,678 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	79,934,887 - 79,989,572 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	144,606,016 - 144,670,696 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	78,431,841 - 78,492,217 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	78,707,973 - 78,721,124 (-)	NCBI
Celera	4	74,170,353 - 74,229,548 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness 5 (ISO)

Hearing Loss (ISO)

Kleefstra syndrome 1 (ISO)

nonsyndromic deafness (ISO)

pleomorphic xanthoastrocytoma (ISO)

rheumatoid arthritis (ISO)

sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-tribromophenol (ISO)

2,4-diaminotoluene (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

azathioprine (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

Calpeptin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

dihydroartemisinin (ISO)

disulfiram (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead(0) (ISO)

lead(2+) (ISO)

menadione (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-ethyl-N-nitrosourea (ISO)

N-methylformamide (ISO)

N-nitrosodimethylamine (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

prednisolone (ISO)

progesterone (ISO)

quercetin (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium aurothiomalate (ISO)

sunitinib (ISO)

temozolomide (ISO)

thioacetamide (EXP)

tributylstannane (ISO)

trichostatin A (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cell death (ISO)

cellular response to tumor necrosis factor (ISO)

cellular response to virus (ISO)

granzyme-mediated programmed cell death signaling pathway (ISO)

inner ear auditory receptor cell differentiation (ISO)

inner ear receptor cell differentiation (ISO)

necrotic cell death (IBA,ISO)

negative regulation of cell population proliferation (ISO)

positive regulation of immune response to tumor cell (ISO)

positive regulation of intrinsic apoptotic signaling pathway (ISO)

positive regulation of MAPK cascade (ISO)

pyroptosis (ISO)

Cellular Component

cellular_component (ND)

cytoplasm (IBA,ISO)

cytosol (IEA,ISO)

membrane (ISO)

plasma membrane (ISO)

Molecular Function

cardiolipin binding (ISO)

phosphatidylinositol-4,5-bisphosphate binding (ISO)

protein binding (ISO)

wide pore channel activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A yeast model for the study of human DFNA5, a gene mutated in nonsyndromic hearing impairment.	Gregan J, etal., Biochim Biophys Acta 2003 Jul 14;1638(2):179-86.
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Nonsyndromic hearing impairment is associated with a mutation in DFNA5.	Van Laer L, etal., Nat Genet. 1998 Oct;20(2):194-7.

Additional References at PubMed

PMID:16023581	PMID:18223688	PMID:21522185	PMID:26236191	PMID:28045099	PMID:28459430

Genomics

Comparative Map Data

Gsdme
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	79,258,799 - 79,321,129 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	79,257,804 - 79,320,806 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	84,481,566 - 84,538,385 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	80,257,093 - 80,313,918 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	78,697,400 - 78,754,225 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	79,934,075 - 79,999,678 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	79,934,887 - 79,989,572 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	144,606,016 - 144,670,696 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	78,431,841 - 78,492,217 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	78,707,973 - 78,721,124 (-)	NCBI
Celera	4	74,170,353 - 74,229,548 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

GSDME
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	24,698,355 - 24,795,539 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	7	24,698,355 - 24,757,940 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	24,737,974 - 24,797,558 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	24,704,499 - 24,764,164 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	24,511,214 - 24,570,603	NCBI
Celera	7	24,726,449 - 24,786,103 (-)	NCBI		Celera
Cytogenetic Map	7	p15.3	NCBI
HuRef	7	24,622,538 - 24,682,209 (-)	NCBI		HuRef
CHM1_1	7	24,739,537 - 24,799,201 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	24,836,367 - 24,895,946 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	24,789,534 - 24,849,193 (-)	NCBI

Gsdme
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	50,167,013 - 50,240,837 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	50,165,868 - 50,240,842 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	50,207,401 - 50,263,857 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	50,188,888 - 50,263,862 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	50,157,402 - 50,211,768 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	50,136,989 - 50,191,355 (-)	NCBI		MGSCv36	mm8
Celera	6	50,724,199 - 50,778,504 (-)	NCBI		Celera
Cytogenetic Map	6	B2.3	NCBI

Gsdme
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	26,701,893 - 26,769,989 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955410	26,700,977 - 26,761,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

GSDME
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	7	24,977,838 - 25,039,525 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	24,977,838 - 25,039,525 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	7	25,373,485 - 25,433,001 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GSDME
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	38,210,975 - 38,286,729 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	38,211,540 - 38,292,280 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	37,761,175 - 37,836,931 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	38,147,520 - 38,223,342 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	38,147,531 - 38,220,379 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	38,261,120 - 38,336,198 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	37,953,705 - 38,029,068 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	38,295,918 - 38,371,682 (-)	NCBI		UU_Cfam_GSD_1.0

Gsdme
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	82,443,029 - 82,508,175 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936478	1,655,487 - 1,720,996 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GSDME
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	47,526,797 - 47,583,731 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	47,524,637 - 47,583,748 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	52,434,841 - 52,489,985 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GSDME
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	33,611,068 - 33,671,497 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	33,612,013 - 33,672,461 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	70,981,267 - 71,041,514 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gsdme
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	5,798,771 - 5,871,088 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624739	5,790,372 - 5,879,979 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gsdme
396 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	496
Count of miRNA genes:	254
Interacting mature miRNAs:	316
Transcripts:	ENSRNOT00000013264
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	102114432	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	62933508	82490359	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
2317586	Eae25	Experimental allergic encephalomyelitis QTL 25	9.300000190734863		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	78882817	83007655	Rat
2317586	Eae25	Experimental allergic encephalomyelitis QTL 25	9.300000190734863		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	78882817	83007655	Rat
2317586	Eae25	Experimental allergic encephalomyelitis QTL 25	9.300000190734863		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	78882817	83007655	Rat
2317586	Eae25	Experimental allergic encephalomyelitis QTL 25	9.300000190734863		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	4	78882817	83007655	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78885890	102684881	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2								54	11	1
Low	1	41	32	16	19	16	8	10	20	24	35	11	8
Below cutoff		2	21	21		21		1			5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005503244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY194291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000013264 ⟹ ENSRNOP00000013264

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	79,261,512 - 79,310,717 (-)	Ensembl
Rnor_6.0 Ensembl	4	79,934,887 - 79,989,572 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086453 ⟹ ENSRNOP00000073987

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	79,257,804 - 79,320,806 (-)	Ensembl
Rnor_6.0 Ensembl	4	79,944,750 - 79,989,572 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107780 ⟹ ENSRNOP00000081162

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	79,261,512 - 79,310,717 (-)	Ensembl

RefSeq Acc Id:

NM_001191749 ⟹ NP_001178678

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,261,512 - 79,320,804 (-)	NCBI
Rnor_6.0	4	79,934,075 - 79,999,678 (-)	NCBI
Rnor_5.0	4	144,606,016 - 144,670,696 (-)	NCBI
Celera	4	74,170,353 - 74,229,548 (-)	NCBI

Sequence:

show sequence

GTTCCGGACGGAGCGGCAGCGCGCGGGTAATCTCAACCCGACAAAATGTTTGCCAAAGCGACTC
GGAATTTCCTTAAAGAAGTTGATGCTGGAGGAGACCTGATTTCAGTCTCACACTTGAACGACTC
TGACAAGCTGCAACTTCTAAGTCTGGTGACCAAAAAGAAGAGATACTGGTGCTGGCAGAGACCC
AAGTACCAGTTCTTATCGGCCACCCTGGGAGATGTTCTTACAGAAGGGCACTGTCTCAGTCCAG
TGGTTGTGGAGTCAGACTTCGTAAAATACGAAAGCAAGTGTGAGAACCACAAGAGCGGGACTAT
CGGGACCGTCATGGGGAAGGTCAAGCTGAATGTTGGAGGCAAAGGCCTGGTGGAGAGTCAGTCT
TCGTTTGGAACTCTGAGGAAGCAGGAGGTAGATGTGCAGCAACTCATTCAGGATGCCGTCGGGA
GAACAGTTAATCTGGACAGCCTGGTGCTCCAGCAGGTGCTAGAGAGCAGGAACGAGGTCCTGTG
CGTGCTGACGCAGAAGATCGTGACAACACAGAAGTGTGTGATTTCTGAGCACGTGCAGTCGGAG
GAGACGTGCGGAGGCATGGTGGGGATCCAGACCAAGATTGTGCAGGTGCCACACCTCAGCATGG
AGGACGTTTCTCACGGAAGACTCAGGAGGGCTGTATTTGGAAGTGGCCTGCGTGAGGCATGGCG
TAAGTCTACAGTCATGCCAGAATTCTGCCTCCTTCAAGGGAAACATGGTGGCTTCGAGCAGGAG
AGGAAAGTAGATTCTGTCTACTTGGACCCCCTGGCCTACAGAGAGTTTGCCTTTCTGGACATGC
CAGATGGGGGTCAAGGGATCTCTTCACAGGATGGGCCACTACGTGTTTTAAAACAAGCAACCCT
GCACCTAGAGAGGAGCTTCCGTTCCTTTGCGGTGTTGCCTGCCCAGCAGCAGATGGCGCTGTTC
TGCATCCTGCAGAAAATCCTGTTTGATGAAGAACTCCTTAGGGCCCTGGAGCAAGTGTGTGATG
ATGTGGCTGGTGGCCTCTGGTCCTCACAGGCTATATTGGCAATGGAGGAGCTGACAGGCAGTCA
GCAGCAGGACCTCACAGCCTTCCTGAAACTGGTGGGATACAGGGTACAGGGAGAGCATCCTGGC
CCGCAGGATGAGGTCAGCAACCAGAAGCTCTTTGCAACAGCCTACTTCTTGGTCAGTGCACTAG
CAGAAATGCCAGATAATGCCACAGTCTTCCTGGGGACTTGCTGCAAACTCCATGTTATTCCTTC
ACTGTGCCATTTGCTCCATGCTCTGTCTGATGACAGTGTGTGTGATTTTCAAGACCCCACCTTG
GCTCCTCTGAGAGACACAGAGAGGTTTGGCATCGTGCAGCGTTTGTTTGCCTCCGCCGACATTG
CCCTGGAGAGGATGCAGTTTTCTGCCAAAGCCACCATCCTGAAGGACTCCTGCATGTTCCCGCT
AATTCTTCATATCACTCTTAGTGGGCTTTACACTTTAAGCAAAGAGCATGAGGAACATCTTTTT
CAGTCAGAAGTACATGCTACCAGCCAAGACTAGGTACTTCTTAGGATTAATACTTTGGGATTTG
GGGCCGAAGCAGGTTAAGCCTGTCAGTGAATTCCAATGCACACCAGGAGTGGTATCTTTCTGTA
CTGTGGACAAGCACTGTAAATGGGTAATTTTCATCAGAGGCCTACTGTGCCAACACCTGAGTTA
GAGGGAAGAACCACCTTTTACTTTATTTTCCACTCACTTGTGATATACAAAACCAAAAATCTCA
GATTTTACATCAGTTCATCATAAGCTGTGAATGCACAGGGAAGCATGTCCTTTGGACATGCTGT
ACAATGCTGGGTGACTGGGAACTAGAAATGCTACTGGGATATATAAAACAATTATAATAAGAAC
ATCTCATTTTACCCACCTCAACATGAGAATTTAAATCTATTCCTCATATTTGGCTTTGTTATCC
TTTGATGAACATACTATGTCTGGGGCAATTCCAGTGCATTCTGGGAATCTGTCACATGTTGCAA
TTGCTATCGAAGGCAATTCTGAACATGTGTAGTTGGATGTTCATTAAGTTTTGAAGTCCTTCTG
CTTCCCCAGACTTGAACAGTCTTCTCAAGTCTCCTGATTGCACTGAGAGCATGTTACTATTGAT
CAGACCCAATGCCCCTGGGCACATCAAGCAGTGGGATGAATGTTAGCTCCCACTTCATCCACGG
GCACCTTCAGATTATAAGGAAGAGTTAACAAAGATAAAGTACGTCGTTTCTTTTAAACATGAGA
CTCAACCTTATGCAGCTCCCTATTACAGGGTTTATAAAGTTGCACACCAGCAACACTGCTCACG
AACTAACCATAAA

hide sequence

RefSeq Acc Id:

XM_039107726 ⟹ XP_038963654

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,258,799 - 79,321,127 (-)	NCBI

RefSeq Acc Id:

XM_039107727 ⟹ XP_038963655

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,258,799 - 79,321,127 (-)	NCBI

RefSeq Acc Id:

XM_039107728 ⟹ XP_038963656

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,262,389 - 79,321,129 (-)	NCBI

RefSeq Acc Id:

XM_039107729 ⟹ XP_038963657

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,258,799 - 79,321,129 (-)	NCBI

RefSeq Acc Id:

XM_039107730 ⟹ XP_038963658

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,262,389 - 79,321,126 (-)	NCBI

RefSeq Acc Id:

XM_039107731 ⟹ XP_038963659

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,258,799 - 79,321,127 (-)	NCBI

RefSeq Acc Id:

XM_039107732 ⟹ XP_038963660

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,279,857 - 79,321,126 (-)	NCBI

RefSeq Acc Id:

XR_005503244

RefSeq Status:

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	79,262,467 - 79,321,127 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178678	(Get FASTA)	NCBI Sequence Viewer
	XP_038963654	(Get FASTA)	NCBI Sequence Viewer
	XP_038963655	(Get FASTA)	NCBI Sequence Viewer
	XP_038963656	(Get FASTA)	NCBI Sequence Viewer
	XP_038963657	(Get FASTA)	NCBI Sequence Viewer
	XP_038963658	(Get FASTA)	NCBI Sequence Viewer
	XP_038963659	(Get FASTA)	NCBI Sequence Viewer
	XP_038963660	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP35047	(Get FASTA)	NCBI Sequence Viewer
	EDL88198	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001178678 ⟸ NM_001191749

- UniProtKB:

A0A8I5ZRE3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFAKATRNFLKEVDAGGDLISVSHLNDSDKLQLLSLVTKKKRYWCWQRPKYQFLSATLGDVLTE
GHCLSPVVVESDFVKYESKCENHKSGTIGTVMGKVKLNVGGKGLVESQSSFGTLRKQEVDVQQL
IQDAVGRTVNLDSLVLQQVLESRNEVLCVLTQKIVTTQKCVISEHVQSEETCGGMVGIQTKIVQ
VPHLSMEDVSHGRLRRAVFGSGLREAWRKSTVMPEFCLLQGKHGGFEQERKVDSVYLDPLAYRE
FAFLDMPDGGQGISSQDGPLRVLKQATLHLERSFRSFAVLPAQQQMALFCILQKILFDEELLRA
LEQVCDDVAGGLWSSQAILAMEELTGSQQQDLTAFLKLVGYRVQGEHPGPQDEVSNQKLFATAY
FLVSALAEMPDNATVFLGTCCKLHVIPSLCHLLHALSDDSVCDFQDPTLAPLRDTERFGIVQRL
FASADIALERMQFSAKATILKDSCMFPLILHITLSGLYTLSKEHEEHLFQSEVHATSQD

hide sequence

RefSeq Acc Id:

ENSRNOP00000073987 ⟸ ENSRNOT00000086453

RefSeq Acc Id:

ENSRNOP00000013264 ⟸ ENSRNOT00000013264

RefSeq Acc Id:	XP_038963657 ⟸ XM_039107729
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038963659 ⟸ XM_039107731
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038963655 ⟸ XM_039107727
- Peptide Label:	isoform X1
- UniProtKB:	F1MAG0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963654 ⟸ XM_039107726
- Peptide Label:	isoform X1
- UniProtKB:	F1MAG0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963656 ⟸ XM_039107728
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038963658 ⟸ XM_039107730
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038963660 ⟸ XM_039107732
- Peptide Label:	isoform X6

RefSeq Acc Id:

ENSRNOP00000081162 ⟸ ENSRNOT00000107780

Protein Domains

Gasdermin Gasdermin_C

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1MAG0-F1-model_v2	AlphaFold	F1MAG0	1-513	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727871	AgrOrtholog
BioCyc Gene	G2FUF-44898	BioCyc
Ensembl Genes	ENSRNOG00000009970	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000013264	ENTREZGENE
	ENSRNOP00000013264.8	UniProtKB/TrEMBL
	ENSRNOP00000073987	ENTREZGENE
	ENSRNOP00000073987.2	UniProtKB/TrEMBL
	ENSRNOP00000081162	ENTREZGENE
	ENSRNOP00000081162.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013264	ENTREZGENE
	ENSRNOT00000013264.8	UniProtKB/TrEMBL
	ENSRNOT00000086453	ENTREZGENE
	ENSRNOT00000086453.2	UniProtKB/TrEMBL
	ENSRNOT00000107780	ENTREZGENE
	ENSRNOT00000107780.1	UniProtKB/TrEMBL
InterPro	Gasdermin_pore	UniProtKB/TrEMBL
	Gasdermin_PUB	UniProtKB/TrEMBL
	GSDME	UniProtKB/TrEMBL
NCBI Gene	353316	ENTREZGENE
PANTHER	PTHR15207	UniProtKB/TrEMBL
Pfam	Gasdermin	UniProtKB/TrEMBL
	Gasdermin_C	UniProtKB/TrEMBL
PhenoGen	Gsdme	PhenoGen
UniProt	A0A0G2K6Y3_RAT	UniProtKB/TrEMBL
	A0A8I5ZRE3	ENTREZGENE, UniProtKB/TrEMBL
	F1MAG0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-28	Gsdme	gasdermin E	Dfna5	DFNA5, deafness associated tumor suppressor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-03-02	Dfna5	DFNA5, deafness associated tumor suppressor	Dfna5	deafness, autosomal dominant 5 (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-11-06	Dfna5	deafness, autosomal dominant 5 (human)	Dfna5h	deafness, autosomal dominant 5 homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Dfna5h	deafness, autosomal dominant 5 homolog (human)			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM