Advanced Search (OLGA)

Gene: Cxcl11 (C-X-C motif chemokine ligand 11) Rattus norvegicus

Analyze

Symbol:

Cxcl11

Name:

C-X-C motif chemokine ligand 11

RGD ID:

727827

Description:

Enables chemokine activity. Involved in immune response. Predicted to be located in extracellular space and membrane. Biomarker of interstitial cystitis. Orthologous to human CXCL11 (C-X-C motif chemokine ligand 11); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; Toll-like receptor signaling pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-X-C motif chemokine 11; chemokine (C-X-C motif) ligand 11; SCYB11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	15,973,728 - 15,976,503 (+)	NCBI		GRCr8
mRatBN7.2	14	15,689,432 - 15,692,207 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	15,689,424 - 15,692,271 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	15,697,639 - 15,700,419 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	17,016,484 - 17,019,264 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	15,711,911 - 15,714,691 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	17,195,395 - 17,198,170 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	17,195,014 - 17,198,291 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	17,111,527 - 17,114,302 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	17,250,648 - 17,253,423 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	17,250,647 - 17,253,423 (+)	NCBI
Celera	14	15,083,879 - 15,086,654 (+)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	bacterial pneumonia		ISO	RGD:1316123	5135459		RGD
Cxcl11	Rat	bronchiolitis obliterans		ISO	RGD:1316123	5135451		RGD
Cxcl11	Rat	bronchiolitis obliterans		ISO	RGD:1316122	5135451	protein:increased expression:respiratory system fluid/secretion	RGD
Cxcl11	Rat	chronic obstructive pulmonary disease		ISO	RGD:1316122	5135436	protein:increased expression:sputum	RGD
Cxcl11	Rat	COVID-19		ISO	RGD:1316122	9068941	mRNA:increased expression:bronchoalveolar lavage (human)	RGD	PMID:32407669\|REF_RGD_ID:30296672
Cxcl11	Rat	extrinsic allergic alveolitis		ISO	RGD:1316123	5135448		RGD
Cxcl11	Rat	graft-versus-host disease		ISO	RGD:1316123	5135435	protein:increased expression:intestine, liver, lung	RGD
Cxcl11	Rat	hepatocellular carcinoma		ISO	RGD:1316123	11344640	mRNA:increased expression:liver (mouse)	RGD
Cxcl11	Rat	inhalation anthrax	disease_progression	ISO	RGD:1316123	5135283		RGD
Cxcl11	Rat	interstitial cystitis		IEP		407445927	mRNA:increased expression:urinary bladder	RGD
Cxcl11	Rat	pulmonary sarcoidosis		ISO	RGD:1316122	5135438	protein:increased expression:serum	RGD
Cxcl11	Rat	severe acute respiratory syndrome	treatment	ISO	RGD:1316123	32716426		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	progressive myoclonus epilepsy		ISO	RGD:1316122	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy	ClinVar	PMID:19847901\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	celiac disease		ISO	RGD:1316122	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30097691
Cxcl11	Rat	interstitial cystitis		ISO	RGD:1316122	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18957084
Cxcl11	Rat	pancreatic ductal carcinoma		ISO	RGD:1316122	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:24979617

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CXCL11 mRNA]	CTD	PMID:31150632
Cxcl11	Rat	(-)-demecolcine	increases expression	ISO	RGD:1316122	6480464	Demecolcine results in increased expression of CXCL11 mRNA	CTD	PMID:23649840
Cxcl11	Rat	1,1-dichloroethene	increases expression	ISO	RGD:1316123	6480464	vinylidene chloride results in increased expression of CXCL11 mRNA	CTD	PMID:26682919
Cxcl11	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1316123	6480464	1,2-Dimethylhydrazine results in decreased expression of CXCL11 mRNA	CTD	PMID:22206623
Cxcl11	Rat	1-nitropyrene	increases expression	ISO	RGD:1316122	6480464	1-nitropyrene results in increased expression of CXCL11 mRNA	CTD	PMID:19428942\|PMID:19879285
Cxcl11	Rat	17beta-estradiol	increases expression	ISO	RGD:1316122	6480464	Estradiol results in increased expression of CXCL11 mRNA	CTD	PMID:15557169
Cxcl11	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1316122	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of CXCL11 mRNA; [Progesterone co-treated with more ...	CTD	PMID:15557169\|PMID:17404688\|PMID:30165855
Cxcl11	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1316123	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of CXCL11 mRNA	CTD	PMID:30294300
Cxcl11	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1316123	6480464	Tetrachlorodibenzodioxin results in increased expression of CXCL11 mRNA	CTD	PMID:21889950
Cxcl11	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1316122	6480464	Tetrachlorodibenzodioxin results in increased expression of CXCL11 mRNA	CTD	PMID:28351761
Cxcl11	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1316123	6480464	Tetrachlorodibenzodioxin affects the expression of CXCL11 mRNA	CTD	PMID:21570461\|PMID:28922406
Cxcl11	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1316122	6480464	Tetrachlorodibenzodioxin affects the expression of CXCL11 mRNA	CTD	PMID:22298810
Cxcl11	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of CXCL11 mRNA	CTD	PMID:21215274
Cxcl11	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CXCL11 mRNA	CTD	PMID:22298810
Cxcl11	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of CXCL11 mRNA	CTD	PMID:21346803
Cxcl11	Rat	2-amino-2-deoxy-D-glucopyranose	multiple interactions	EXP		6480464	Glucosamine inhibits the reaction [IL1B results in increased expression of CXCL11 mRNA]	CTD	PMID:17109745
Cxcl11	Rat	22-Hydroxycholesterol	increases expression	ISO	RGD:1316122	6480464	22-hydroxycholesterol results in increased expression of CXCL11 mRNA	CTD	PMID:19426978
Cxcl11	Rat	3,3',4,4',5-pentachlorobiphenyl	increases expression	ISO	RGD:1316122	6480464	3,4,5,3',4'-pentachlorobiphenyl results in increased expression of CXCL11 mRNA	CTD	PMID:28351761
Cxcl11	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1316123	6480464	[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ...	CTD	PMID:23503329
Cxcl11	Rat	4-(ethoxymethylene)-2-phenyloxazol-5-one	increases expression	EXP		6480464	Oxazolone results in increased expression of CXCL11 mRNA	CTD	PMID:21893156
Cxcl11	Rat	4-nitroquinoline N-oxide	increases expression	ISO	RGD:1316123	6480464	4-Nitroquinoline-1-oxide results in increased expression of CXCL11 mRNA	CTD	PMID:22561872
Cxcl11	Rat	aflatoxin B1	increases expression	ISO	RGD:1316122	6480464	Aflatoxin B1 results in increased expression of CXCL11 mRNA	CTD	PMID:22100608
Cxcl11	Rat	aldehydo-D-glucosamine	multiple interactions	EXP		6480464	Glucosamine inhibits the reaction [IL1B results in increased expression of CXCL11 mRNA]	CTD	PMID:17109745
Cxcl11	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1316122	6480464	Tretinoin results in decreased expression of CXCL11 mRNA	CTD	PMID:21934132
Cxcl11	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CXCL11 mRNA	CTD	PMID:35163327
Cxcl11	Rat	antirheumatic drug	decreases expression	ISO	RGD:1316122	6480464	Antirheumatic Agents results in decreased expression of CXCL11 mRNA	CTD	PMID:24449571
Cxcl11	Rat	asperentin	decreases expression	ISO	RGD:1316123	6480464	cladosporin results in decreased expression of CXCL11 mRNA	CTD	PMID:19818335
Cxcl11	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1316123	6480464	Benzo(a)pyrene results in decreased expression of CXCL11 mRNA	CTD	PMID:20713471
Cxcl11	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1316122	6480464	Benzo(a)pyrene results in increased expression of CXCL11 mRNA	CTD	PMID:28351761\|PMID:32234424
Cxcl11	Rat	beta-D-glucosamine	multiple interactions	EXP		6480464	Glucosamine inhibits the reaction [IL1B results in increased expression of CXCL11 mRNA]	CTD	PMID:17109745
Cxcl11	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of CXCL11 mRNA	CTD	PMID:18164116
Cxcl11	Rat	beta-naphthoflavone	increases expression	ISO	RGD:1316122	6480464	beta-Naphthoflavone results in increased expression of CXCL11 mRNA	CTD	PMID:32151702
Cxcl11	Rat	bilirubin IXalpha	increases expression	ISO	RGD:1316122	6480464	Bilirubin results in increased expression of CXCL11 mRNA	CTD	PMID:20196124
Cxcl11	Rat	biotin	decreases expression	ISO	RGD:1316122	6480464	Biotin results in decreased expression of CXCL11 mRNA	CTD	PMID:15219929
Cxcl11	Rat	bis(2-chloroethyl) sulfide	increases expression	ISO	RGD:1316123	6480464	Mustard Gas results in increased expression of CXCL11 mRNA	CTD	PMID:19778212
Cxcl11	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CXCL11 mRNA	CTD	PMID:25181051
Cxcl11	Rat	bisphenol F	decreases expression	ISO	RGD:1316123	6480464	bisphenol F results in decreased expression of CXCL11 mRNA	CTD	PMID:38685157
Cxcl11	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of CXCL11 mRNA	CTD	PMID:24136188
Cxcl11	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of CXCL11 promoter	CTD	PMID:22457795
Cxcl11	Rat	cadmium dichloride	decreases expression	ISO	RGD:1316122	6480464	Cadmium Chloride results in decreased expression of CXCL11 mRNA	CTD	PMID:38382870
Cxcl11	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of CXCL11 mRNA	CTD	PMID:33453195
Cxcl11	Rat	calcitriol	increases expression	ISO	RGD:1316122	6480464	Calcitriol results in increased expression of CXCL11 mRNA	CTD	PMID:21592394
Cxcl11	Rat	calcitriol	multiple interactions	ISO	RGD:1316122	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of CXCL11 mRNA	CTD	PMID:21592394
Cxcl11	Rat	calcitriol	decreases expression	ISO	RGD:1316122	6480464	Calcitriol results in decreased expression of CXCL11 mRNA	CTD	PMID:16002434
Cxcl11	Rat	cannabidiol	multiple interactions	ISO	RGD:1316122	6480464	Cannabidiol inhibits the reaction [TNF protein results in increased expression of CXCL11 mRNA]	CTD	PMID:31250491
Cxcl11	Rat	carbon monoxide	multiple interactions	ISO	RGD:1316123	6480464	[Air Pollutants results in increased abundance of [Carbon Monoxide co-treated with Nitrogen Oxides co-treated with more ...	CTD	PMID:29621558
Cxcl11	Rat	carbon nanotube	decreases expression	ISO	RGD:1316123	6480464	Nanotubes, Carbon analog results in decreased expression of CXCL11 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
Cxcl11	Rat	carbon nanotube	increases expression	ISO	RGD:1316122	6480464	Nanotubes, Carbon results in increased expression of CXCL11 mRNA	CTD	PMID:26683310\|PMID:29348435
Cxcl11	Rat	chenodeoxycholic acid	increases expression	ISO	RGD:1316123	6480464	Chenodeoxycholic Acid results in increased expression of CXCL11 mRNA	CTD	PMID:21224055
Cxcl11	Rat	chondroitin sulfate	multiple interactions	ISO	RGD:1316122	6480464	Chondroitin Sulfates inhibits the reaction [CTSB protein results in increased degradation of CXCL11 protein]; Chondroitin more ...	CTD	PMID:25833952
Cxcl11	Rat	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of CXCL11 mRNA	CTD	PMID:22023808
Cxcl11	Rat	cisplatin	multiple interactions	ISO	RGD:1316123	6480464	[Cisplatin co-treated with TNF protein] results in increased expression of CXCL11 mRNA	CTD	PMID:23103562
Cxcl11	Rat	cobalt atom	multiple interactions	ISO	RGD:1316123	6480464	[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ...	CTD	PMID:23503329
Cxcl11	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of CXCL11 mRNA	CTD	PMID:24386269
Cxcl11	Rat	cyclophosphamide	increases expression	ISO	RGD:1316123	6480464	Cyclophosphamide results in increased expression of CXCL11 protein	CTD	PMID:18957084
Cxcl11	Rat	deoxycholic acid	increases expression	ISO	RGD:1316123	6480464	Deoxycholic Acid results in increased expression of CXCL11 mRNA	CTD	PMID:21224055
Cxcl11	Rat	deoxynivalenol	decreases expression	ISO	RGD:1316123	6480464	deoxynivalenol results in decreased expression of CXCL11 mRNA	CTD	PMID:22968694
Cxcl11	Rat	deoxynivalenol	increases expression	ISO	RGD:1316122	6480464	deoxynivalenol results in increased expression of CXCL11 mRNA	CTD	PMID:27757495
Cxcl11	Rat	dexamethasone	multiple interactions	ISO	RGD:1316123	6480464	[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ...	CTD	PMID:23503329
Cxcl11	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of CXCL11 mRNA	CTD	PMID:29391264
Cxcl11	Rat	erlotinib hydrochloride	multiple interactions	ISO	RGD:1316122	6480464	[Gemcitabine co-treated with Erlotinib Hydrochloride] affects the expression of CXCL11 protein	CTD	PMID:24979617
Cxcl11	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:1316122	6480464	Ethyl Methanesulfonate results in increased expression of CXCL11 mRNA	CTD	PMID:23649840
Cxcl11	Rat	fentanyl	increases expression	EXP		6480464	Fentanyl results in increased expression of CXCL11 mRNA	CTD	PMID:36032789
Cxcl11	Rat	folic acid	decreases expression	ISO	RGD:1316123	6480464	Folic Acid results in decreased expression of CXCL11 mRNA	CTD	PMID:25629700
Cxcl11	Rat	formaldehyde	increases expression	ISO	RGD:1316122	6480464	Formaldehyde results in increased expression of CXCL11 mRNA	CTD	PMID:23649840
Cxcl11	Rat	formaldehyde	decreases expression	ISO	RGD:1316122	6480464	Formaldehyde results in decreased expression of CXCL11 mRNA	CTD	PMID:28937961
Cxcl11	Rat	fragrance	increases expression	ISO	RGD:1316122	6480464	Perfume results in increased expression of CXCL11 mRNA	CTD	PMID:24768652
Cxcl11	Rat	fulvestrant	multiple interactions	ISO	RGD:1316122	6480464	fulvestrant inhibits the reaction [Estradiol results in increased expression of CXCL11 mRNA]	CTD	PMID:15557169
Cxcl11	Rat	fumonisin B1	increases expression	ISO	RGD:1316122	6480464	fumonisin B1 results in increased expression of CXCL11 mRNA	CTD	PMID:27757495
Cxcl11	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of CXCL11 gene	CTD	PMID:22079235
Cxcl11	Rat	gadodiamide hydrate	increases secretion	ISO	RGD:1316122	6480464	gadodiamide results in increased secretion of CXCL11 protein	CTD	PMID:20959327
Cxcl11	Rat	gadodiamide hydrate	increases expression	ISO	RGD:1316122	6480464	gadodiamide results in increased expression of CXCL11 mRNA	CTD	PMID:20959327
Cxcl11	Rat	gemcitabine	multiple interactions	ISO	RGD:1316122	6480464	[Gemcitabine co-treated with Erlotinib Hydrochloride] affects the expression of CXCL11 protein	CTD	PMID:24979617
Cxcl11	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of CXCL11 mRNA	CTD	PMID:22061828\|PMID:33387578
Cxcl11	Rat	graphene oxide	decreases expression	ISO	RGD:1316123	6480464	graphene oxide analog results in decreased expression of CXCL11 mRNA; graphene oxide results in decreased more ...	CTD	PMID:33227293
Cxcl11	Rat	irinotecan	affects expression	EXP		6480464	Irinotecan affects the expression of CXCL11 mRNA	CTD	PMID:20097248
Cxcl11	Rat	iron(2+) sulfate (anhydrous)	increases expression	ISO	RGD:1316122	6480464	ferrous sulfate results in increased expression of CXCL11 mRNA	CTD	PMID:19428942
Cxcl11	Rat	lipopolysaccharide	increases expression	ISO	RGD:1316122	6480464	Lipopolysaccharides results in increased expression of CXCL11 mRNA	CTD	PMID:19428942\|PMID:35811015
Cxcl11	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1316122	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of CXCL11 mRNA; S-(1,2-dichlorovinyl)cysteine inhibits the reaction more ...	CTD	PMID:35811015
Cxcl11	Rat	malathion	increases expression	ISO	RGD:1316122	6480464	Malathion results in increased expression of CXCL11 mRNA	CTD	PMID:37047231
Cxcl11	Rat	methotrexate	decreases expression	ISO	RGD:1316122	6480464	Methotrexate results in decreased expression of CXCL11 mRNA	CTD	PMID:17400583
Cxcl11	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of CXCL11 mRNA	CTD	PMID:21515302
Cxcl11	Rat	mycotoxin	decreases expression	ISO	RGD:1316123	6480464	Mycotoxins results in decreased expression of CXCL11 mRNA	CTD	PMID:19818335
Cxcl11	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of CXCL11 mRNA	CTD	PMID:18164116
Cxcl11	Rat	N-Nitrosopyrrolidine	increases expression	ISO	RGD:1316122	6480464	N-Nitrosopyrrolidine results in increased expression of CXCL11 mRNA	CTD	PMID:32234424
Cxcl11	Rat	nickel atom	multiple interactions	ISO	RGD:1316123	6480464	[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ...	CTD	PMID:23503329
Cxcl11	Rat	nickel atom	increases expression	ISO	RGD:1316122	6480464	Nickel results in increased expression of CXCL11 mRNA	CTD	PMID:24768652\|PMID:25583101
Cxcl11	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of CXCL11 mRNA	CTD	PMID:22110744
Cxcl11	Rat	nickel dichloride	multiple interactions	ISO	RGD:1316122	6480464	nickel chloride inhibits the reaction [lipopolysaccharide, E. coli O26-B6 results in increased expression of CXCL11 more ...	CTD	PMID:23090859
Cxcl11	Rat	nimesulide	multiple interactions	ISO	RGD:1316123	6480464	[nimesulide results in decreased activity of PTGS2 protein] which results in increased expression of CXCL11 more ...	CTD	PMID:22561872
Cxcl11	Rat	okadaic acid	increases expression	ISO	RGD:1316122	6480464	Okadaic Acid results in increased expression of CXCL11 mRNA	CTD	PMID:38832940
Cxcl11	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of CXCL11 mRNA	CTD	PMID:25729387
Cxcl11	Rat	ozone	increases expression	ISO	RGD:1316123	6480464	Ozone results in increased expression of CXCL11 mRNA	CTD	PMID:27240593
Cxcl11	Rat	paraquat	increases expression	ISO	RGD:1316122	6480464	Paraquat results in increased expression of CXCL11 mRNA	CTD	PMID:22230393
Cxcl11	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CXCL11 mRNA	CTD	PMID:35163327
Cxcl11	Rat	phenylephrine	decreases expression	EXP		6480464	Phenylephrine results in decreased expression of CXCL11 mRNA	CTD	PMID:18158353
Cxcl11	Rat	pirinixic acid	decreases expression	ISO	RGD:1316123	6480464	pirinixic acid results in decreased expression of CXCL11 mRNA	CTD	PMID:23811191
Cxcl11	Rat	potassium dichromate	increases expression	ISO	RGD:1316123	6480464	Potassium Dichromate results in increased expression of CXCL11 mRNA	CTD	PMID:23608068
Cxcl11	Rat	progesterone	multiple interactions	ISO	RGD:1316122	6480464	[Progesterone co-treated with Estradiol] results in increased expression of CXCL11 mRNA	CTD	PMID:17404688
Cxcl11	Rat	progesterone	increases expression	ISO	RGD:1316122	6480464	Progesterone results in increased expression of CXCL11 mRNA	CTD	PMID:15557169\|PMID:17404688
Cxcl11	Rat	rotenone	affects expression	EXP		6480464	Rotenone affects the expression of CXCL11 mRNA	CTD	PMID:28374803
Cxcl11	Rat	ruxolitinib	multiple interactions	ISO	RGD:1316122	6480464	ruxolitinib inhibits the reaction [IFNB1 protein results in increased expression of CXCL11 mRNA]; ruxolitinib inhibits more ...	CTD	PMID:22941906\|PMID:28365849
Cxcl11	Rat	ruxolitinib	decreases expression	ISO	RGD:1316122	6480464	ruxolitinib results in decreased expression of CXCL11 mRNA	CTD	PMID:22941906
Cxcl11	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1316122	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of CXCL11 mRNA; S-(1,2-dichlorovinyl)cysteine inhibits the reaction more ...	CTD	PMID:35811015
Cxcl11	Rat	silicon dioxide	increases expression	ISO	RGD:1316122	6480464	Silicon Dioxide analog results in increased expression of CXCL11 mRNA; Silicon Dioxide results in increased more ...	CTD	PMID:19428942\|PMID:23806026
Cxcl11	Rat	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide results in increased expression of CXCL11 mRNA	CTD	PMID:22431001\|PMID:32721576
Cxcl11	Rat	silicon dioxide	increases expression	ISO	RGD:1316123	6480464	Silicon Dioxide results in increased expression of CXCL11 mRNA	CTD	PMID:23221170\|PMID:38811393
Cxcl11	Rat	sodium arsenite	increases expression	ISO	RGD:1316123	6480464	sodium arsenite results in increased expression of CXCL11 mRNA	CTD	PMID:21911445
Cxcl11	Rat	sotorasib	increases expression	ISO	RGD:1316123	6480464	sotorasib results in increased expression of CXCL11 mRNA	CTD	PMID:31666701
Cxcl11	Rat	sterigmatocystin	decreases expression	ISO	RGD:1316123	6480464	Sterigmatocystin results in decreased expression of CXCL11 mRNA	CTD	PMID:19818335
Cxcl11	Rat	succimer	multiple interactions	ISO	RGD:1316122	6480464	[Succimer co-treated with Magnetite Nanoparticles] results in increased expression of CXCL11 mRNA	CTD	PMID:26378955
Cxcl11	Rat	sulfur dioxide	multiple interactions	ISO	RGD:1316123	6480464	[Air Pollutants results in increased abundance of [Carbon Monoxide co-treated with Nitrogen Oxides co-treated with more ...	CTD	PMID:29621558
Cxcl11	Rat	tacrolimus hydrate	increases expression	ISO	RGD:1316123	6480464	Tacrolimus results in increased expression of CXCL11 mRNA	CTD	PMID:23958496
Cxcl11	Rat	taurocholic acid	increases expression	ISO	RGD:1316123	6480464	Taurocholic Acid results in increased expression of CXCL11 mRNA	CTD	PMID:21224055
Cxcl11	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of CXCL11 mRNA	CTD	PMID:21515302
Cxcl11	Rat	testosterone	increases expression	ISO	RGD:1316122	6480464	Testosterone results in increased expression of CXCL11 mRNA	CTD	PMID:21592394
Cxcl11	Rat	testosterone	multiple interactions	ISO	RGD:1316122	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of CXCL11 mRNA	CTD	PMID:21592394
Cxcl11	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CXCL11 mRNA]	CTD	PMID:31150632
Cxcl11	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of CXCL11 mRNA	CTD	PMID:31150632
Cxcl11	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of CXCL11 mRNA	CTD	PMID:34492290
Cxcl11	Rat	titanium dioxide	increases expression	ISO	RGD:1316122	6480464	titanium dioxide results in increased expression of CXCL11 mRNA	CTD	PMID:19695317
Cxcl11	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of CXCL11 mRNA	CTD	PMID:30012374
Cxcl11	Rat	titanium dioxide	increases expression	ISO	RGD:1316123	6480464	titanium dioxide results in increased expression of CXCL11 mRNA	CTD	PMID:21259345
Cxcl11	Rat	TMC-120A	decreases expression	ISO	RGD:1316123	6480464	TMC 120A results in decreased expression of CXCL11 mRNA	CTD	PMID:19818335
Cxcl11	Rat	tofacitinib	decreases expression	ISO	RGD:1316122	6480464	tofacitinib results in decreased expression of CXCL11 mRNA	CTD	PMID:22941906
Cxcl11	Rat	tofacitinib	multiple interactions	ISO	RGD:1316122	6480464	tofacitinib inhibits the reaction [TNF protein results in increased expression of CXCL11 mRNA]	CTD	PMID:22941906
Cxcl11	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of CXCL11 mRNA	CTD	PMID:25729387
Cxcl11	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of CXCL11 mRNA	CTD	PMID:33387578
Cxcl11	Rat	trimellitic anhydride	increases expression	EXP		6480464	trimellitic anhydride results in increased expression of CXCL11 mRNA	CTD	PMID:21893156
Cxcl11	Rat	triphenyl phosphate	increases expression	EXP		6480464	triphenyl phosphate results in increased expression of CXCL11 mRNA	CTD	PMID:30589522
Cxcl11	Rat	Triptolide	affects expression	ISO	RGD:1316123	6480464	triptolide affects the expression of CXCL11 mRNA	CTD	PMID:32835833
Cxcl11	Rat	urethane	decreases expression	ISO	RGD:1316122	6480464	Urethane results in decreased expression of CXCL11 mRNA	CTD	PMID:28818685
Cxcl11	Rat	valproic acid	decreases methylation	ISO	RGD:1316122	6480464	Valproic Acid results in decreased methylation of CXCL11 gene	CTD	PMID:29154799
Cxcl11	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of CXCL11 mRNA	CTD	PMID:23034163
Cxcl11	Rat	vincristine	increases expression	ISO	RGD:1316122	6480464	Vincristine results in increased expression of CXCL11 mRNA	CTD	PMID:23649840
Cxcl11	Rat	zinc atom	multiple interactions	ISO	RGD:1316123	6480464	[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ...	CTD	PMID:23503329
Cxcl11	Rat	zinc dichloride	increases expression	ISO	RGD:1316122	6480464	zinc chloride results in increased expression of CXCL11 mRNA	CTD	PMID:19428942
Cxcl11	Rat	zinc(0)	multiple interactions	ISO	RGD:1316123	6480464	[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with more ...	CTD	PMID:23503329

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	ISO	RGD:1316122	1624291	PMID:12782716	RGD	PMID:12782716
Cxcl11	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	antimicrobial humoral immune response mediated by antimicrobial peptide	involved_in	ISO	RGD:1316122,UniProtKB:O14625-PRO_0000005106	1624291	PMID:12949249	RGD	PMID:12949249
Cxcl11	Rat	chemokine-mediated signaling pathway	involved_in	ISO	RGD:1316122	1624291	PMID:18645041	RGD	PMID:18645041
Cxcl11	Rat	chemokine-mediated signaling pathway	involved_in	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	chemotaxis	involved_in	ISO	RGD:1316122	1624291	PMID:12782716	RGD	PMID:12782716
Cxcl11	Rat	chemotaxis	involved_in	IEA	InterPro:IPR033899	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cxcl11	Rat	chemotaxis	involved_in	IEA	UniProtKB-KW:KW-0145	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cxcl11	Rat	chemotaxis	involved_in	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	defense response	involved_in	IEA	InterPro:IPR033899	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cxcl11	Rat	immune response		IMP		1302904		RGD
Cxcl11	Rat	immune response	involved_in	IEA	InterPro:IPR001089\|InterPro:IPR001811\|InterPro:IPR018048\|InterPro:IPR036048	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cxcl11	Rat	positive regulation of release of sequestered calcium ion into cytosol	involved_in	ISO	RGD:1316122	1624291	PMID:12782716	RGD	PMID:12782716
Cxcl11	Rat	positive regulation of release of sequestered calcium ion into cytosol	involved_in	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	regulation of cell population proliferation	involved_in	ISO	RGD:1316122	1624291	PMID:12782716	RGD	PMID:12782716
Cxcl11	Rat	regulation of cell population proliferation	involved_in	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	response to lipid	involved_in	IEA	ARBA:ARBA00028073	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Cxcl11	Rat	T cell chemotaxis	involved_in	ISO	RGD:1316122	1624291	PMID:18645041	RGD	PMID:18645041
Cxcl11	Rat	T cell chemotaxis	involved_in	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	extracellular region	located_in	IEA	InterPro:IPR001089\|InterPro:IPR001811\|InterPro:IPR018048\|InterPro:IPR036048	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cxcl11	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cxcl11	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cxcl11	Rat	extracellular space	located_in	IEA	UniRule:UR000083251	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Cxcl11	Rat	extracellular space	located_in	IEA	UniProtKB-KW:KW-0202	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cxcl11	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	chemokine activity		IMP		1302904		RGD
Cxcl11	Rat	chemokine activity	enables	IEA	InterPro:IPR001089\|InterPro:IPR001811\|InterPro:IPR018048\|InterPro:IPR033899\|InterPro:IPR036048\|InterPro:IPR039809	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Cxcl11	Rat	chemokine activity	enables	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	chemokine activity	enables	ISO	RGD:1316122	1624291	PMID:12782716	RGD	PMID:12782716
Cxcl11	Rat	chemokine receptor binding		TAS		1302904		RGD
Cxcl11	Rat	CXCR3 chemokine receptor binding	enables	ISO	RGD:1316122	1624291	PMID:12782716	RGD	PMID:12782716
Cxcl11	Rat	CXCR3 chemokine receptor binding	enables	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	cytokine activity	enables	IEA	UniProtKB-KW:KW-0202	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cxcl11	Rat	heparin binding	enables	ISO	RGD:1316122	1624291	PMID:18645041	RGD	PMID:18645041
Cxcl11	Rat	heparin binding	enables	IEA	UniProtKB:O14625\|ensembl:ENSP00000306884	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cxcl11	Rat	protein binding	enables	ISO	RGD:1316122	1624291	UniProtKB:O00175\|UniProtKB:O95715\|UniProtKB:P02776\|UniProtKB:P10720\|UniProtKB:P13501\|UniProtKB:P27487\|UniProtKB:P48061\|UniProtKB:Q5JR59\|UniProtKB:Q99616\|UniProtKB:Q9Y258 PMID:18275857, PMID:21314817, PMID:25416956, PMID:28381538	RGD	PMID:18275857\|PMID:21314817\|PMID:25416956\|PMID:28381538
Cxcl11	Rat	protein binding	enables	ISO	RGD:1316122,UniProtKB:O14625-PRO_0000005106	1624291	UniProtKB:P98066 PMID:27044744	RGD	PMID:27044744

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cxcl11	Rat	chemokine mediated signaling pathway		IEA		6907045		KEGG	rno:04062
Cxcl11	Rat	cytokine mediated signaling pathway		IEA		6907045		KEGG	rno:04060
Cxcl11	Rat	Toll-like receptor signaling pathway		IEA		6907045		KEGG	rno:04620

Disease Annotations Click to see Annotation Detail View

bacterial pneumonia (ISO)

bronchiolitis obliterans (ISO)

celiac disease (ISO)

chronic obstructive pulmonary disease (ISO)

COVID-19 (ISO)

extrinsic allergic alveolitis (ISO)

graft-versus-host disease (ISO)

hepatocellular carcinoma (ISO)

inhalation anthrax (ISO)

interstitial cystitis (IEP,ISO)

pancreatic ductal carcinoma (ISO)

progressive myoclonus epilepsy (ISO)

pulmonary sarcoidosis (ISO)

severe acute respiratory syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-amino-2-deoxy-D-glucopyranose (EXP)

22-Hydroxycholesterol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-nitroquinoline N-oxide (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

asperentin (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (EXP)

beta-naphthoflavone (EXP,ISO)

bilirubin IXalpha (ISO)

biotin (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

buspirone (EXP)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon monoxide (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

chondroitin sulfate (ISO)

cisplatin (EXP,ISO)

cobalt atom (ISO)

cobalt dichloride (EXP)

cyclophosphamide (ISO)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

endosulfan (EXP)

erlotinib hydrochloride (ISO)

ethyl methanesulfonate (ISO)

fentanyl (EXP)

folic acid (ISO)

formaldehyde (ISO)

fragrance (ISO)

fulvestrant (ISO)

fumonisin B1 (ISO)

furan (EXP)

gadodiamide hydrate (ISO)

gemcitabine (ISO)

gentamycin (EXP)

graphene oxide (ISO)

irinotecan (EXP)

iron(2+) sulfate (anhydrous) (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

methotrexate (ISO)

Muraglitazar (EXP)

mycotoxin (ISO)

N-nitrosodiethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nimesulide (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paraquat (ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

progesterone (ISO)

rotenone (EXP)

ruxolitinib (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sotorasib (ISO)

sterigmatocystin (ISO)

succimer (ISO)

sulfur dioxide (ISO)

tacrolimus hydrate (ISO)

taurocholic acid (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

TMC-120A (ISO)

tofacitinib (ISO)

topotecan (EXP)

trichloroethene (EXP)

trimellitic anhydride (EXP)

triphenyl phosphate (EXP)

Triptolide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IEA,ISO)

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

chemokine-mediated signaling pathway (IEA,ISO)

chemotaxis (IEA,ISO)

defense response (IEA)

immune response (IEA,IMP)

positive regulation of release of sequestered calcium ion into cytosol (IEA,ISO)

regulation of cell population proliferation (IEA,ISO)

response to lipid (IEA)

T cell chemotaxis (IEA,ISO)

Cellular Component

extracellular region (IEA)

extracellular space (IEA)

membrane (IEA)

Molecular Function

chemokine activity (IEA,IMP,ISO)

chemokine receptor binding (TAS)

CXCR3 chemokine receptor binding (IEA,ISO)

cytokine activity (IEA)

heparin binding (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

cytokine mediated signaling pathway (IEA)

Toll-like receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Critical role for CXCR3 chemokine biology in the pathogenesis of bronchiolitis obliterans syndrome.	Belperio JA, etal., J Immunol. 2002 Jul 15;169(2):1037-49.
2.	CXCR3 and CCR5 chemokines in induced sputum from patients with COPD.	Costa C, etal., Chest. 2008 Jan;133(1):26-33. Epub 2007 Oct 9.
3.	Interferon-inducible CXC chemokines directly contribute to host defense against inhalational anthrax in a murine model of infection.	Crawford MA, etal., PLoS Pathog. 2010 Nov 18;6(11):e1001199.
4.	Hepatocyte-Specific Arid1a Deficiency Initiates Mouse Steatohepatitis and Hepatocellular Carcinoma.	Fang JZ, etal., PLoS One. 2015 Nov 16;10(11):e0143042. doi: 10.1371/journal.pone.0143042. eCollection 2015.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	A SARS-CoV-2 Infection Model in Mice Demonstrates Protection by Neutralizing Antibodies.	Hassan AO, etal., Cell. 2020 Jun 10. pii: S0092-8674(20)30742-X. doi: 10.1016/j.cell.2020.06.011.
7.	Elucidation of the pathophysiology of interstitial cystitis/bladder pain syndrome via experimental autoimmune cystitis rat model.	Kadekawa K, etal., Am J Physiol Regul Integr Comp Physiol. 2024 Aug 1;327(2):R250-R260. doi: 10.1152/ajpregu.00269.2023. Epub 2024 Jun 6.
8.	Lymphoid follicle cells in chronic obstructive pulmonary disease overexpress the chemokine receptor CXCR3.	Kelsen SG, etal., Am J Respir Crit Care Med. 2009 May 1;179(9):799-805. Epub 2009 Feb 12.
9.	Expression of rat I-TAC/CXCL11/SCYA11 during central nervous system inflammation: comparison with other CXCR3 ligands.	McColl SR, etal., Lab Invest 2004 Nov;84(11):1418-29.
10.	Chemokine production during hypersensitivity pneumonitis.	Nance S, etal., Eur J Immunol. 2004 Mar;34(3):677-85.
11.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
12.	CXCL9 and 11 in patients with pulmonary sarcoidosis: a role of alveolar macrophages.	Nishioka Y, etal., Clin Exp Immunol. 2007 Aug;149(2):317-26. Epub 2007 Jun 5.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	CXCR3 and its ligands participate in the host response to Bordetella bronchiseptica infection of the mouse respiratory tract but are not required for clearance of bacteria from the lung.	Widney DP, etal., Infect Immun. 2005 Jan;73(1):485-93.

Additional References at PubMed

PMID:12477932	PMID:12782716	PMID:12949249	PMID:17264982	PMID:18645041

Genomics

Comparative Map Data

Cxcl11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	15,973,728 - 15,976,503 (+)	NCBI		GRCr8
mRatBN7.2	14	15,689,432 - 15,692,207 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	15,689,424 - 15,692,271 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	15,697,639 - 15,700,419 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	17,016,484 - 17,019,264 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	15,711,911 - 15,714,691 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	17,195,395 - 17,198,170 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	17,195,014 - 17,198,291 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	17,111,527 - 17,114,302 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	17,250,648 - 17,253,423 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	17,250,647 - 17,253,423 (+)	NCBI
Celera	14	15,083,879 - 15,086,654 (+)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

CXCL11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	76,033,682 - 76,036,070 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	76,033,682 - 76,041,415 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	76,954,835 - 76,957,223 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	77,173,859 - 77,176,257 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	77,312,020 - 77,314,412	NCBI
Celera	4	74,255,322 - 74,257,722 (-)	NCBI		Celera
Cytogenetic Map	4	q21.1	NCBI
HuRef	4	72,707,280 - 72,709,795 (-)	NCBI		HuRef
CHM1_1	4	76,931,383 - 76,933,900 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	79,374,343 - 79,376,731 (-)	NCBI		T2T-CHM13v2.0

Cxcl11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	92,507,403 - 92,511,155 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	92,507,403 - 92,513,344 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	92,359,544 - 92,363,296 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	92,359,544 - 92,365,485 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	92,788,570 - 92,792,303 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	93,434,744 - 93,438,477 (-)	NCBI		MGSCv36	mm8
Celera	5	90,503,193 - 90,506,930 (-)	NCBI		Celera
Cytogenetic Map	5	E2	NCBI
cM Map	5	46.61	NCBI

Cxcl11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	766,272 - 771,231 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	769,449 - 771,137 (-)	NCBI	ChiLan1.0	ChiLan1.0

CXCL11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	54,037,310 - 54,039,639 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	54,227,065 - 54,229,394 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	48,169,954 - 48,172,455 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	54,007,818 - 54,010,343 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	54,007,818 - 54,010,336 (+)	Ensembl	panpan1.1		panPan2

CXCL11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	631,084 - 636,997 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	631,478 - 632,868 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	32	631,478 - 632,868 (-)	NCBI	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	32	655,797 - 662,280 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	32	655,531 - 661,573 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	609,837 - 615,880 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	39,553,718 - 39,589,852 (+)	NCBI		UU_Cfam_GSD_1.0

Cxcl11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	11,433,511 - 11,435,471 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936676	71,667 - 73,738 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936676	72,383 - 73,697 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CXCL11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	71,713,803 - 71,725,674 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	71,713,790 - 71,725,669 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	75,909,581 - 75,921,427 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CXCL11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	24,540,401 - 24,543,456 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	24,541,767 - 24,542,832 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	2,882,698 - 2,885,219 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cxcl11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	14,952,851 - 14,954,905 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	14,952,966 - 14,954,343 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cxcl11
15 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	72
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000031667
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3813074	18274691	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11030812	30320092	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	28035204	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1217606	16960180	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	14875168	30883947	Rat

Markers in Region

RH128858

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	15,691,988 - 15,692,208 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	17,197,952 - 17,198,171	NCBI	Rnor6.0
Rnor_5.0	14	17,114,084 - 17,114,303	UniSTS	Rnor5.0
RGSC_v3.4	14	17,253,205 - 17,253,424	UniSTS	RGSC3.4
Celera	14	15,086,436 - 15,086,655	UniSTS
RH 3.4 Map	14	164.4	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	47	80	91	90	59	25	59	6	210	94	60	40	48	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_182952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF537209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY340181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031667 ⟹ ENSRNOP00000035380

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	15,689,424 - 15,692,271 (+)	Ensembl
Rnor_6.0 Ensembl	14	17,195,014 - 17,198,291 (+)	Ensembl

RefSeq Acc Id:

NM_182952 ⟹ NP_891997

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	15,973,728 - 15,976,503 (+)	NCBI
mRatBN7.2	14	15,689,432 - 15,692,207 (+)	NCBI
Rnor_6.0	14	17,195,395 - 17,198,170 (+)	NCBI
Rnor_5.0	14	17,111,527 - 17,114,302 (+)	NCBI
RGSC_v3.4	14	17,250,648 - 17,253,423 (+)	RGD
Celera	14	15,083,879 - 15,086,654 (+)	RGD

Sequence:

show sequence

TGCTGCTCTCTGCGAAGAAAGATCACCAGAGCCACAGCAGAGAGCTGCAGCTGCCGCTGAGATG
AACAGGACGGGCATGGCCGTAGCCCTGGCTATGATCATCTGGGCCACAACGGTTCCAGGCTTCG
TTATGTTCAAAGGGGGGCGCTGTCTTTGCATCGACCGCGGAGTGAAAGTGGTCAAAATGGCAGC
AATCAAGGAAGTTTCTGTAATTTACCCGAGTAACGGCTGTGACAAAGTTGAAGTGATTGTTACC
CTGAAGGCTCATAAAGGACAAAGGTGCCTGGACCCCACATCCAAGCAAGCTCGCCTCATAATGC
AGACAATACAAAAAAAGAATTTTTTAAGGCGCCAGAACATGTGATGGGCCCTCAAATTCGAGCT
CTGTGCCAAGAAGCTGACCCTCTCCTGTCTTGGAATATGCATCCGTTTTGCCAGATTGCAGAAC
TCGCTAGGAGGTCGGATACCTCTAAACTATTCTGCTTGGCTATGAAAATATTTATCTCGAAGAG
TCATGTGTCTCTGTGTGTGCACACTCCGAGTTATCGTCTATGGTTACAATGGACACATTGTTAC
TGGAATCCCGCCCGCCCGCTGGTTGGATTCAGAAGCATCTAGTGTAGAAAAACATTACTCAAGG
AATTTTTCATGGAAATAACATCCCTTTCCCCAAATAACACGAGGCACATGAACATCTAGGAAGA
AGATTCCACATATCATCTTGCTTGTACATTTAAAAAGATTTAGCATTCATGAGGTGCCCTGCAA
ACATTTCTACGCTGTAGAAACGAGTAAGAGAACACTACTGTTTCCTGAGTTAATCACACTGGCT
TCCCACTGAGGCAGTCTAAAGGGCTAAAGATGTGTATTTCCTGTACATCTGGCTTTATCTGTTT
TATCAGTGACAATAATCTGGATAGATTTTTAAAATAAATTGCTTTTGCTCACCAAAGAAAATGT
TGGAAAAAAAATCTATTCATCTCTTTGAGTCTGTTTTCCATTATTCTGCCTTTGAAAAAAATAT
GTAAATGTGTACTTGGTCCTTTCCTTTGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_891997	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68725	(Get FASTA)	NCBI Sequence Viewer
	AAQ02665	(Get FASTA)	NCBI Sequence Viewer
	AAQ10776	(Get FASTA)	NCBI Sequence Viewer
	EDL88638	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035380
	ENSRNOP00000035380.3

RefSeq Acc Id:	NP_891997 ⟸ NM_182952
- Peptide Label:	precursor
- UniProtKB:	Q7TNL0 (UniProtKB/TrEMBL), B5DEM2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNRTGMAVALAMIIWATTVPGFVMFKGGRCLCIDRGVKVVKMAAIKEVSVIYPSNGCDKVEVIV TLKAHKGQRCLDPTSKQARLIMQTIQKKNFLRRQNM hide sequence

Ensembl Acc Id:

ENSRNOP00000035380 ⟸ ENSRNOT00000031667

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TNL0-F1-model_v2	AlphaFold	Q7TNL0	1-100	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699210

Promoter ID:

EPDNEW_R9735

Type:

single initiation site

Name:

Cxcl11_1

Description:

C-X-C motif chemokine ligand 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	17,195,387 - 17,195,447	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727827	AgrOrtholog
BioCyc Gene	G2FUF-16261	BioCyc
Ensembl Genes	ENSRNOG00000022298	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031667	ENTREZGENE
	ENSRNOT00000031667.5	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.40	UniProtKB/TrEMBL
InterPro	Chemokine_b/g/d	UniProtKB/TrEMBL
	Chemokine_IL8	UniProtKB/TrEMBL
	CXC_Chemokine_domain	UniProtKB/TrEMBL
	CXC_chmkine_smll	UniProtKB/TrEMBL
	Interleukin_8-like_sf	UniProtKB/TrEMBL
	Small_chemokine_CXC_CS	UniProtKB/TrEMBL
KEGG Report	rno:305236	UniProtKB/TrEMBL
NCBI Gene	305236	ENTREZGENE
PANTHER	C-X-C MOTIF CHEMOKINE 11	UniProtKB/TrEMBL
	SMALL INDUCIBLE CYTOKINE A	UniProtKB/TrEMBL
Pfam	IL8	UniProtKB/TrEMBL
PhenoGen	Cxcl11	PhenoGen
PRINTS	INTERLEUKIN8	UniProtKB/TrEMBL
	SMALLCYTKCXC	UniProtKB/TrEMBL
PROSITE	SMALL_CYTOKINES_CXC	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022298	RatGTEx
SMART	SCY	UniProtKB/TrEMBL
Superfamily-SCOP	Chemokine_IL8	UniProtKB/TrEMBL
UniProt	B5DEM2	ENTREZGENE, UniProtKB/TrEMBL
	Q7TNL0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Cxcl11	C-X-C motif chemokine ligand 11	Cxcl11	chemokine (C-X-C motif) ligand 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Cxcl11	chemokine (C-X-C motif) ligand 11			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)