Csrp3 (cysteine and glycine rich protein 3)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Csrp3 (cysteine and glycine rich protein 3) Rattus norvegicus

Analyze

Symbol:

Csrp3

Name:

cysteine and glycine rich protein 3

RGD ID:

71092

Description:

Enables MRF binding activity and RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in blood vessel remodeling. Acts upstream of or within positive regulation of myotube differentiation. Located in Z disc and nucleus. Human ortholog(s) of this gene implicated in dilated cardiomyopathy; dilated cardiomyopathy 1M; hypertrophic cardiomyopathy; and hypertrophic cardiomyopathy 12. Orthologous to human CSRP3 (cysteine and glycine rich protein 3); INTERACTS WITH 1-benzylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine; 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CRP3; cysteine and glycine rich protein 3 c-terminal HA-tagged; cysteine and glycine rich protein 3 lacking the LIM1-domain; cysteine and glycine rich protein 3 N-terminal nuclear localization sequence; cysteine and glycine-rich protein 3; cysteine and glycine-rich protein 3 (cardiac LIM protein); cysteine-rich protein 3; LIM domain protein, cardiac; MLP; muscle LIM protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CSRP3 (cysteine and glycine rich protein 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Csrp3 (cysteine and glycine-rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Csrp3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CSRP3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CSRP3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Csrp3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CSRP3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CSRP3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Csrp3 (cysteine and glycine rich protein 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CSRP2 (cysteine and glycine rich protein 2)	HGNC	OrthoDB
Homo sapiens (human):	RPS2 (ribosomal protein S2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CSRP3 (cysteine and glycine rich protein 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Csrp3 (cysteine and glycine-rich protein 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	csrp3 (cysteine and glycine-rich protein 3 (cardiac LIM protein))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	LRG1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	mlp-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mlp84B	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	csrp3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	98,528,067 - 98,546,647 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	98,528,068 - 98,546,653 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	103,881,687 - 103,900,350 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	112,353,629 - 112,372,274 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	105,676,355 - 105,694,925 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	104,147,205 - 104,166,389 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	104,147,206 - 104,166,367 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	105,206,459 - 105,225,635 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	98,601,681 - 98,611,747 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	98,679,791 - 98,689,858 (-)	NCBI
Celera	1	92,735,902 - 92,745,962 (-)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Disease Models (ISO)

cardiomyopathy (ISO)

congestive heart failure (ISS)

dilated cardiomyopathy (ISO)

dilated cardiomyopathy 1M (ISO,ISS)

familial hypertrophic cardiomyopathy (ISO)

genetic disease (ISO)

hypertrophic cardiomyopathy (ISO,ISS)

hypertrophic cardiomyopathy 1 (ISO)

hypertrophic cardiomyopathy 12 (ISO,ISS)

intellectual disability (ISO)

long QT syndrome (ISO)

lung adenocarcinoma (ISO)

progressive myoclonus epilepsy 7 (ISO)

Right Ventricular Hypertrophy (IEP)

substance-related disorder (ISO)

Sudden Death (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1-benzylpiperazine (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

amitriptyline (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Botulinum toxin type A (EXP)

cantharidin (ISO)

carmustine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

copper atom (EXP)

copper(0) (EXP)

corticosterone (EXP)

cyclosporin A (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dichlorine (EXP)

diethyl maleate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

Echimidine (EXP)

genistein (EXP)

Heliotrine (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

inulin (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (EXP)

manganese(0) (EXP)

manganese(II) chloride (EXP)

mercury dichloride (EXP)

methotrexate (ISO)

methoxychlor (EXP)

Muraglitazar (EXP)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

naphthalenes (EXP)

nitrofen (EXP)

ozone (EXP,ISO)

paracetamol (ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylephrine (EXP)

pioglitazone (ISO)

pirinixic acid (ISO)

potassium bromate (EXP)

progesterone (EXP)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-nitroso-N-acetyl-D-penicillamine (EXP)

streptozocin (EXP)

sulforaphane (ISO)

sunitinib (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

triclosan (ISO)

troglitazone (EXP)

valproic acid (ISO)

vanadyl sulfate (EXP)

verapamil (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood vessel remodeling (IEP)

cardiac muscle contraction (IBA,IEA,ISO)

cardiac muscle hypertrophy (IEA,ISO)

cardiac muscle tissue development (ISO)

cardiac myofibril assembly (IEA,ISO)

detection of muscle stretch (IEA,ISO)

glucose homeostasis (IEA,ISO)

heart development (ISO)

inflammatory response (IEA,ISO)

insulin receptor signaling pathway (IEA,ISO)

intracellular calcium ion homeostasis (IEA,ISO)

muscle cell cellular homeostasis (IEA,ISO)

muscle organ development (IEA)

muscle tissue development (IBA)

negative regulation of actin filament severing (ISO)

negative regulation of myoblast differentiation (ISO)

positive regulation of actin filament severing (ISO)

positive regulation of myoblast differentiation (ISO)

positive regulation of myotube differentiation (IDA,IGI)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

protein kinase C signaling (IEA,ISO)

protein localization to organelle (IEA,ISO)

regulation of protein localization to plasma membrane (IEA,ISO)

regulation of the force of heart contraction (IEA,ISO)

sarcomere organization (IBA)

T-tubule organization (IEA,ISO)

Cellular Component

cytoplasm (IBA,IDA)

cytoskeleton (IEA)

cytosol (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IDA)

Z disc (IBA,IDA,IEA,ISO)

Molecular Function

actin binding (IEA)

actinin binding (IBA,IEA,ISO)

identical protein binding (IEA,ISO)

metal ion binding (IEA)

MRF binding (IDA)

protein binding (IPI,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IPI)

structural constituent of muscle (IBA,IEA,ISO)

telethonin binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Muscle LIM protein, a novel essential regulator of myogenesis, promotes myogenic differentiation.	Arber S, etal., Cell 1994 Oct 21;79(2):221-31.
2.	Downregulation and nuclear relocation of MLP during the progression of right ventricular hypertrophy induced by chronic pressure overload.	Ecarnot-Laubriet A, etal., J Mol Cell Cardiol. 2000 Dec;32(12):2385-95.
3.	The muscle regulatory and structural protein MLP is a cytoskeletal binding partner of betaI-spectrin.	Flick MJ and Konieczny SF, J Cell Sci. 2000 May;113 ( Pt 9):1553-64.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Mutations in the human muscle LIM protein gene in families with hypertrophic cardiomyopathy.	Geier C, etal., Circulation. 2003 Mar 18;107(10):1390-5.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	The cardiac mechanical stretch sensor machinery involves a Z disc complex that is defective in a subset of human dilated cardiomyopathy.	Knoll R, etal., Cell 2002 Dec 27;111(7):943-55.
8.	Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD.	Kong Y, etal., Mol Cell Biol. 1997 Aug;17(8):4750-60.
9.	Gene Data Set	MGD Curation, June 12, 2002
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
13.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
14.	Heterozygous osteopetrotic (op) mutation reduces atherosclerosis in LDL receptor- deficient mice.	Rajavashisth T, etal., J Clin Invest 1998 Jun 15;101(12):2702-10.
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	A role for muscle LIM protein (MLP) in vascular remodeling.	Wang X, etal., J Mol Cell Cardiol. 2006 Apr;40(4):503-9. Epub 2006 Mar 6.

Additional References at PubMed

PMID:10555147	PMID:12127981	PMID:12477932	PMID:15582318	PMID:15665106	PMID:16322914	PMID:19351738	PMID:19376126	PMID:22421737	PMID:24860983	PMID:24945278	PMID:27353086
PMID:28706255	PMID:29634311	PMID:30673598	PMID:32914385

Genomics

Comparative Map Data

Csrp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	98,528,067 - 98,546,647 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	98,528,068 - 98,546,653 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	103,881,687 - 103,900,350 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	112,353,629 - 112,372,274 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	105,676,355 - 105,694,925 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	104,147,205 - 104,166,389 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	104,147,206 - 104,166,367 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	105,206,459 - 105,225,635 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	98,601,681 - 98,611,747 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	98,679,791 - 98,689,858 (-)	NCBI
Celera	1	92,735,902 - 92,745,962 (-)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

CSRP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	19,182,030 - 19,201,983 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	19,182,030 - 19,210,571 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	19,203,577 - 19,223,530 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	19,160,154 - 19,180,177 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	19,160,153 - 19,180,177	NCBI
Celera	11	19,336,055 - 19,356,021 (-)	NCBI		Celera
Cytogenetic Map	11	p15.1	NCBI
HuRef	11	18,887,548 - 18,916,047 (-)	NCBI		HuRef
CHM1_1	11	19,202,919 - 19,231,414 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	19,302,167 - 19,322,081 (-)	NCBI		T2T-CHM13v2.0

Csrp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	48,480,146 - 48,497,799 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	48,480,146 - 48,497,781 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	48,830,398 - 48,848,051 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	48,830,398 - 48,848,033 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	56,085,768 - 56,099,021 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	48,698,419 - 48,711,672 (-)	NCBI		MGSCv36	mm8
Celera	7	44,274,422 - 44,287,671 (-)	NCBI		Celera
Cytogenetic Map	7	B4	NCBI
cM Map	7	31.11	NCBI

Csrp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955476	154,917 - 176,616 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955476	155,913 - 176,122 (-)	NCBI	ChiLan1.0	ChiLan1.0

CSRP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	11	21,447,665 - 21,467,550 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	19,208,025 - 19,228,000 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	19,121,234 - 19,149,374 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	19,121,234 - 19,140,820 (-)	Ensembl	panpan1.1		panPan2

CSRP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	41,300,277 - 41,318,788 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	41,300,425 - 41,318,738 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	40,778,804 - 40,797,354 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	42,423,567 - 42,442,117 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	42,423,567 - 42,442,039 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	41,425,878 - 41,444,425 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	41,603,282 - 41,621,845 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	41,980,467 - 41,999,019 (-)	NCBI		UU_Cfam_GSD_1.0

Csrp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	43,636,738 - 43,655,378 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936654	271,067 - 289,823 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936654	271,067 - 313,251 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CSRP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	40,215,353 - 40,240,616 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	40,219,288 - 40,240,614 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	43,258,339 - 43,279,704 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CSRP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	45,792,106 - 45,813,715 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	45,803,243 - 45,813,800 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	143,137,913 - 143,148,273 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Csrp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	10,611,804 - 10,631,490 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624766	10,611,798 - 10,631,567 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Csrp3
87 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	73
Count of miRNA genes:	58
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000019311
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	94494440	117601394	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat

Markers in Region

RH128977

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	98,528,076 - 98,528,263 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	104,147,215 - 104,147,401	NCBI	Rnor6.0
Rnor_5.0	1	105,206,469 - 105,206,655	UniSTS	Rnor5.0
RGSC_v3.4	1	98,601,691 - 98,601,877	UniSTS	RGSC3.4
Celera	1	92,735,912 - 92,736,098	UniSTS
RH 3.4 Map	1	923.19	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	43					8	10			1	8	8
Low		19	14	7	14		1	3	4	11	3
Below cutoff		22	11	9	11			29	30	23

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR027881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR027883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR027892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR027893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X81193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000019311 ⟹ ENSRNOP00000019310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	98,528,068 - 98,538,135 (-)	Ensembl
Rnor_6.0 Ensembl	1	104,147,206 - 104,157,855 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092211 ⟹ ENSRNOP00000071918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	98,530,215 - 98,546,653 (-)	Ensembl
Rnor_6.0 Ensembl	1	104,149,705 - 104,166,367 (-)	Ensembl

RefSeq Acc Id:

NM_057144 ⟹ NP_476485

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	98,528,067 - 98,546,647 (-)	NCBI
Rnor_6.0	1	104,147,205 - 104,157,855 (-)	NCBI
Rnor_5.0	1	105,206,459 - 105,225,635 (-)	NCBI
RGSC_v3.4	1	98,601,681 - 98,611,747 (-)	RGD
Celera	1	92,735,902 - 92,745,962 (-)	RGD

Sequence:

show sequence

TCATCTCGGCAGATTGACTTTGGCCCCTGAGTCTTCACCATGCCGAACTGGGGTGGAGGTGCAA
AATGTGGAGCCTGCGACAAGACGGTTTACCATGCAGAAGAAATCCAGTGCAATGGGAGGAGCTT
CCATAAGACCTGTTTCCACTGCATGGCCTGCAGGAAGGCTCTGGACAGCACCACAGTGGCAGCT
CATGAGTCAGAGATCTACTGTAAGGTCTGCTATGGGCGCAAGTATGGCCCCAAGGGGATCGGGT
TTGGACAAGGCGCTGGCTGCCTCAGCACAGACACCGGCGAGCACCTTGGCCTGCAGTTCCAACA
ATCCCCAAAGCCAGCACGTGCAGCCACCACGAGCAACCCTTCCAAGTTCTCTGCGAAGTTTGGA
GAATCAGAGAAGTGCCCACGATGCGGAAAGTCGGTATATGCTGCTGAGAAGGTCATGGGAGGTG
GCAAGCCCTGGCATAAGACCTGCTTTCCGTGCGCCATCTGTGGGAAGAGCCTGGAGTCCACAAA
TGTCACTGACAAGGATGGGGAGCTTTATTGCAAAGTTTGCTATGCCAAAAATTTTGGCCCCACA
GGCATTGGGTTTGGAGGGCTTACACACCAAGTGGAAAAGAAGGAGTGAAACGGCGTGCTTTCTC
ACAGCCCTGCTAGTCAACAGCAGGGCTTAGTGACCCCATAGATGTAACTTTGGCCCCGCAGCCT
CCTTTGTAGCTGGACTGCATTTCTCTTCAGAAGCAGTCATAGGCTGCACTGACCGTAAAAAGAG
ACCACCGGAAATGAATCTGCAAAAGATGCTTCATTATTTACTATTTTTGGGGTGGGAGAGACAA
TAAACGTTTTAATGGTAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_476485	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA57065	(Get FASTA)	NCBI Sequence Viewer
	EDM07231	(Get FASTA)	NCBI Sequence Viewer
	P50463	(Get FASTA)	NCBI Sequence Viewer
	VCV25291	(Get FASTA)	NCBI Sequence Viewer
	VCV25292	(Get FASTA)	NCBI Sequence Viewer
	VCV25301	(Get FASTA)	NCBI Sequence Viewer
	VCV25302	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_476485 ⟸ NM_057144
- UniProtKB:	P50463 (UniProtKB/Swiss-Prot), G3V7U0 (UniProtKB/TrEMBL), A6JBF3 (UniProtKB/TrEMBL), A0A3S4B5A5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGR KYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVY AAEKVMGGGKPWHKTCFPCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTHQVEK KE hide sequence

RefSeq Acc Id:

ENSRNOP00000071918 ⟸ ENSRNOT00000092211

RefSeq Acc Id:

ENSRNOP00000019310 ⟸ ENSRNOT00000019311

Protein Domains

LIM zinc-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50463-F1-model_v2	AlphaFold	P50463	1-194	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71092	AgrOrtholog
BioCyc Gene	G2FUF-59572	BioCyc
Ensembl Genes	ENSRNOG00000014327	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000019310	ENTREZGENE
	ENSRNOP00000019310.3	UniProtKB/TrEMBL
	ENSRNOP00000071918.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019311	ENTREZGENE
	ENSRNOT00000019311.6	UniProtKB/TrEMBL
	ENSRNOT00000092211.2	UniProtKB/TrEMBL
Gene3D-CATH	Cysteine Rich Protein	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Znf_LIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117505	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	117505	ENTREZGENE
PANTHER	CYSTEINE AND GLYCINE-RICH PROTEIN 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO-GTPASE-ACTIVATING PROTEIN LRG1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	LIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Csrp3	PhenoGen
PROSITE	LIM_DOMAIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LIM_DOMAIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	LIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K1N8_RAT	UniProtKB/TrEMBL
	A0A3S4B5A5	ENTREZGENE, UniProtKB/TrEMBL
	A0A3S4CLA1_RAT	UniProtKB/TrEMBL
	A0A3S4FDI0_RAT	UniProtKB/TrEMBL
	A0A447DUT9_RAT	UniProtKB/TrEMBL
	A6JBF3	ENTREZGENE, UniProtKB/TrEMBL
	CSRP3_RAT	UniProtKB/Swiss-Prot
	G3V7U0	ENTREZGENE, UniProtKB/TrEMBL
	P50463	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Csrp3	cysteine and glycine rich protein 3	Csrp3	cysteine and glycine-rich protein 3 (cardiac LIM protein)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-10	Csrp3	cysteine and glycine-rich protein 3 (cardiac LIM protein)	Csrp3	cysteine and glycine-rich protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Csrp3	cysteine and glycine-rich protein 3		cysteine-rich protein 3	Name updated	1299863	APPROVED
2002-07-09	Csrp3	cysteine-rich protein 3			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM