Enables MRF binding activity and RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in blood vessel remodeling. Acts upstream of or within positive regulation of DNA-binding transcription factor activity and positive regulation of myotube differentiation. Located in Z disc and nucleus. Human ortholog(s) of this gene implicated in dilated cardiomyopathy; dilated cardiomyopathy 1M; hypertrophic cardiomyopathy; and hypertrophic cardiomyopathy 12. Orthologous to human CSRP3 (cysteine and glycine rich protein 3); INTERACTS WITH 1-benzylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine; 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile.
CRP3; cysteine and glycine rich protein 3 c-terminal HA-tagged; cysteine and glycine rich protein 3 lacking the LIM1-domain; cysteine and glycine rich protein 3 N-terminal nuclear localization sequence; cysteine and glycine-rich protein 3; cysteine and glycine-rich protein 3 (cardiac LIM protein); cysteine-rich protein 3; LIM domain protein, cardiac; MLP; muscle LIM protein
[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA]
[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA]
[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CSRP3 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of CSRP3 mRNA
MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGR KYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVY AAEKVMGGGKPWHKTCFPCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTHQVEK KE