Exhibits MRF binding activity and RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in blood vessel remodeling; positive regulation of DNA-binding transcription factor activity; and positive regulation of myotube differentiation. Localizes to the Z disc and nucleus. Human ortholog(s) of this gene implicated in dilated cardiomyopathy; dilated cardiomyopathy 1M; hypertrophic cardiomyopathy; and hypertrophic cardiomyopathy 12. Orthologous to human CSRP3 (cysteine and glycine rich protein 3); INTERACTS WITH 1-benzylpiperazine; 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile; amitriptyline.
CRP3; cysteine and glycine rich protein 3 c-terminal HA-tagged; cysteine and glycine rich protein 3 lacking the LIM1-domain; cysteine and glycine rich protein 3 N-terminal nuclear localization sequence; cysteine and glycine-rich protein 3; cysteine and glycine-rich protein 3 (cardiac LIM protein); cysteine-rich protein 3; LIM domain protein, cardiac; MLP; muscle LIM protein
[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA, PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA]
[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA, PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CSRP3 mRNA]
MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGR KYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVY AAEKVMGGGKPWHKTCFPCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTHQVEK KE
MPNWGGGAKCGACDKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGR KYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVY AAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTHQVEK KE
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Gene-Chemical Interaction Annotations
