Gatm (glycine amidinotransferase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gatm (glycine amidinotransferase) Rattus norvegicus

Analyze

Symbol:

Gatm

Name:

glycine amidinotransferase

RGD ID:

71090

Description:

Enables glycine amidinotransferase activity. Involved in several processes, including embryonic liver development; response to mercury ion; and response to peptide hormone. Located in cytosol and mitochondrion. Biomarker of acute kidney failure and kidney disease. Human ortholog(s) of this gene implicated in AGAT deficiency and Fanconi renotubular syndrome 1. Orthologous to human GATM (glycine amidinotransferase); PARTICIPATES IN creatine metabolic pathway; AGAT deficiency pathway; arginine and proline metabolic pathway; INTERACTS WITH 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AT; glycine amidinotransferase (L-arginine:glycine amidinotransferase); glycine amidinotransferase, mitochondrial; L-arginine: glycine amidinotransferase; L-arginine:glycine amidinotransferase; MGC93388; transamidinase

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	109,658,919 - 109,675,508 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	109,658,951 - 109,684,129 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	113,555,275 - 113,571,827 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	122,150,802 - 122,167,354 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	119,811,184 - 119,827,736 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	114,711,570 - 114,728,155 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	114,711,562 - 114,728,410 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	121,249,707 - 121,266,292 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	109,558,043 - 109,565,432 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	109,463,621 - 109,470,996 (-)	NCBI
Celera	3	108,536,141 - 108,553,426 (-)	NCBI		Celera
RH 3.4 Map	3	965.7	RGD
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (ISO)

acute kidney failure (IEP)

AGAT deficiency (ISO)

Animal Mammary Neoplasms (ISO)

Bloom syndrome (ISO)

carcinoma (ISO)

cerebral creatine deficiency syndrome (ISO)

colorectal cancer (ISO)

congestive heart failure (ISO)

Diabetic Nephropathies (HEP)

epilepsy (ISO)

Experimental Mammary Neoplasms (ISO)

Fanconi renotubular syndrome 1 (ISO)

Fanconi syndrome (ISO)

genetic disease (ISO)

intellectual disability (ISO)

kidney disease (IEP,ISO)

Lennox-Gastaut syndrome (ISO)

myocardial infarction (ISO)

Myocardial Ischemia (ISO)

Necrosis (ISO)

nephrotoxicity (HEP,IMP)

pre-eclampsia (ISO)

transient cerebral ischemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

17beta-estradiol (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-amino-2-deoxy-D-glucopyranose (EXP)

2-hydroxypropanoic acid (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (EXP)

amitrole (EXP)

ammonia (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-D-glucosamine (EXP)

bisphenol A (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (ISO)

clozapine (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

corticosterone (EXP)

creatine (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-penicillamine (EXP)

dibutyl phthalate (EXP)

diquat (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

GW 4064 (ISO)

hydrogen peroxide (ISO)

indometacin (EXP)

lead diacetate (ISO)

leflunomide (ISO)

mercaptopurine (EXP)

mercury dichloride (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-nitrosomorpholine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

progesterone (EXP,ISO)

purine-6-thiol (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

sulfadimethoxine (EXP)

sulforaphane (ISO)

T-2 toxin (EXP)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

creatine biosynthetic process (IBA,IEA,ISO)

creatine metabolic process (ISO)

embryonic liver development (IEP)

kidney development (IDA,IEP)

learning or memory (IEA,ISO)

muscle atrophy (IEA,ISO)

positive regulation of cold-induced thermogenesis (ISO,ISS)

response to mercury ion (IDA)

response to nutrient (IDA)

response to organic substance (IDA)

response to oxidative stress (IEP)

response to peptide hormone (IDA)

tissue regeneration (IEP)

Cellular Component

cytosol (IDA)

mitochondrial inner membrane (IDA,IEA)

mitochondrial intermembrane space (IEA,ISO)

mitochondrion (IBA,IDA,ISO)

Molecular Function

amidinotransferase activity (IBA,IDA,ISO)

glycine amidinotransferase activity (IDA,IEA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

AGAT deficiency pathway (ISO)

arginine and proline metabolic pathway (IEA,ISO)

creatine metabolic pathway (IDA)

dihydropyrimidine dehydrogenase deficiency pathway (ISO)

dimethylglycine dehydrogenase deficiency pathway (ISO)

glycine, serine and threonine metabolic pathway (IEA)

guanidinoacetate methyltransferase deficiency pathway (ISO)

gyrate atrophy pathway (ISO)

hyperprolinemia type I pathway (ISO)

hyperprolinemia type II pathway (ISO)

nonketotic hyperglycinemia pathway (ISO)

ornithine translocase deficiency pathway (ISO)

prolidase deficiency pathway (ISO)

sarcosinemia pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Creatine synthesis and transport during rat embryogenesis: spatiotemporal expression of AGAT, GAMT and CT1.	Braissant O, etal., BMC Dev Biol. 2005 May 26;5:9.
2.	Homoarginine levels are regulated by L-arginine:glycine amidinotransferase and affect stroke outcome: results from human and murine studies.	Choe CU, etal., Circulation. 2013 Sep 24;128(13):1451-61. doi: 10.1161/CIRCULATIONAHA.112.000580. Epub 2013 Sep 4.
3.	Myocardial expression of the arginine:glycine amidinotransferase gene is elevated in heart failure and normalized after recovery: potential implications for local creatine synthesis.	Cullen ME, etal., Circulation. 2006 Jul 4;114(1 Suppl):I16-20. doi: 10.1161/CIRCULATIONAHA.105.000448.
4.	The Effects of Early-Onset Pre-Eclampsia on Placental Creatine Metabolism in the Third Trimester.	Ellery SJ, etal., Int J Mol Sci. 2020 Jan 26;21(3):806. doi: 10.3390/ijms21030806.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Cloning and sequencing of rat kidney L-arginine:glycine amidinotransferase. Studies on the mechanism of regulation by growth hormone and creatine.	Guthmiller P, etal., J Biol Chem 1994 Jul 1;269(26):17556-60.
8.	Novel pathways in the pathobiology of human abdominal aortic aneurysms.	Hinterseher I, etal., Pathobiology. 2013;80(1):1-10. doi: 10.1159/000339303. Epub 2012 Jul 12.
9.	[Study of impaired metabolism of guanidinoacetic acid in uremia--the compensatory role of the pancreas in guanidinoacetic acid synthesis]	Hirata M Nippon Jinzo Gakkai Shi. 1989 Sep;31(9):951-61.
10.	SERUM TRANSAMIDINASE IN RENAL DISEASE.	HORNER WH, etal., Proc Soc Exp Biol Med. 1965 Jan;118:65-9. doi: 10.3181/00379727-118-29757.
11.	Potential biomarkers associated with diabetic glomerulopathy through proteomics.	Hsu YC, etal., Ren Fail. 2015;37(8):1308-15. doi: 10.3109/0886022X.2015.1077321. Epub 2015 Sep 12.
12.	Oxidative stress alters arginine metabolism in rat brain: effect of sub-convulsive hyperbaric oxygen exposure.	Ito T, etal., Neurochem Int. 1996 Aug;29(2):187-95.
13.	[Creatine biosynthesis enzymes in the postnatal development of rats: the role of cyclo-3',5'-AMP and glucagon in the postnatal induction of liver guanidine acetate-N-methyltransferase].	Karelin AA, Ontogenez. 1978;9(2):154-9.
14.	Genetic Depletion of Adipocyte Creatine Metabolism Inhibits Diet-Induced Thermogenesis and Drives Obesity.	Kazak L, etal., Cell Metab. 2017 Oct 3;26(4):660-671.e3. doi: 10.1016/j.cmet.2017.08.009. Epub 2017 Aug 24.
15.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
16.	Urinary guanidinoacetic acid excretion as an indicator of gentamicin nephrotoxicity in rats.	Kiyatake I, etal., Ren Fail. 2004 Jul;26(4):339-44. doi: 10.1081/jdi-120039812.
17.	Interrelation of urinary and plasma levels of guanidinoacetic acid with alteration in renal activity of glycine amidinotransferase in acute renal failure rats.	Kuwagaki Y and Sudo J, Chem Pharm Bull (Tokyo). 1989 Mar;37(3):781-4.
18.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
19.	Metabolomic profiling of metoprolol-induced cardioprotection in a murine model of acute myocardial ischemia.	Lai Q, etal., Biomed Pharmacother. 2020 Apr;124:109820. doi: 10.1016/j.biopha.2020.109820. Epub 2020 Jan 20.
20.	On the biosynthesis of creatine. Intramitochondrial localization of transamidinase from rat kidney.	Magri E, etal., FEBS Lett. 1975 Jul 15;55(1):91-3. doi: 10.1016/0014-5793(75)80966-5.
21.	Gene Data Set	MGD Curation, June 12, 2002
22.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
23.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
24.	Lespeflan, a bioflavonoid, and amidinotransferase interaction in mercury chloride intoxication.	Nikolic J and Sokolovic D, Ren Fail. 2004 Nov;26(6):607-11.
25.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
26.	Identification of genes involved in gentamicin-induced nephrotoxicity in rats--a toxicogenomic investigation.	Ozaki N, etal., Exp Toxicol Pathol. 2010 Sep;62(5):555-66. doi: 10.1016/j.etp.2009.07.004. Epub 2009 Aug 7.
27.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
28.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
29.	GOA pipeline	RGD automated data pipeline
30.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
32.	Comprehensive gene review and curation	RGD comprehensive gene curation
33.	Evidence for the role of pancreatic acinar cells in the production of ornithine and guanidinoacetic acid by L-arginine:glycine amidinotransferase.	Sorenson RL, etal., Pancreas. 1995 May;10(4):389-94. doi: 10.1097/00006676-199505000-00011.
34.	Methylation demand and homocysteine metabolism: effects of dietary provision of creatine and guanidinoacetate.	Stead LM, etal., Am J Physiol Endocrinol Metab. 2001 Nov;281(5):E1095-100.
35.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
36.	Changes in kidney transaminase activity during development in male and female rats.	Tormanen CD and Sutter BE, Biosci Rep. 1985 Apr;5(4):309-14. doi: 10.1007/BF01116902.
37.	Comparison of the properties of purified mitochondrial and cytosolic rat kidney transamidinase.	Tormanen CD, Int J Biochem. 1990;22(11):1243-50. doi: 10.1016/0020-711x(90)90305-m.
38.	Synthesis of neuroactive guanidino compounds by rat kidney L-arginine: glycine amidinotransferase.	Watanabe Y, etal., Life Sci. 1994;55(5):351-8.
39.	Proteomic analysis of differential protein expression in early process of pancreatic regeneration in pancreatectomized rats.	Yang M, etal., Acta Pharmacol Sin. 2006 May;27(5):568-78.

Additional References at PubMed

PMID:3057136	PMID:9218780	PMID:14651853	PMID:15489334	PMID:18614015	PMID:23376485	PMID:23533145	PMID:26490222	PMID:27233232

Genomics

Comparative Map Data

Gatm
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	109,658,919 - 109,675,508 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	109,658,951 - 109,684,129 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	113,555,275 - 113,571,827 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	122,150,802 - 122,167,354 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	119,811,184 - 119,827,736 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	114,711,570 - 114,728,155 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	114,711,562 - 114,728,410 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	121,249,707 - 121,266,292 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	109,558,043 - 109,565,432 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	109,463,621 - 109,470,996 (-)	NCBI
Celera	3	108,536,141 - 108,553,426 (-)	NCBI		Celera
RH 3.4 Map	3	965.7	RGD
Cytogenetic Map	3	q35	NCBI

GATM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	45,361,124 - 45,402,227 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	45,361,124 - 45,402,327 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	45,653,322 - 45,694,425 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	43,440,614 - 43,458,272 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	43,440,613 - 43,457,998	NCBI
Celera	15	22,544,733 - 22,562,401 (-)	NCBI		Celera
Cytogenetic Map	15	q21.1	NCBI
HuRef	15	22,477,507 - 22,495,086 (-)	NCBI		HuRef
CHM1_1	15	45,771,808 - 45,789,455 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	43,169,297 - 43,210,402 (-)	NCBI		T2T-CHM13v2.0

Gatm
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	122,424,954 - 122,441,758 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	122,424,948 - 122,441,784 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	122,594,473 - 122,611,277 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	122,594,467 - 122,611,303 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	122,420,209 - 122,437,013 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	122,285,913 - 122,302,703 (-)	NCBI		MGSCv36	mm8
Celera	2	123,756,992 - 123,773,746 (-)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	60.63	NCBI

Gatm
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	8,068,476 - 8,084,603 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	8,068,524 - 8,084,603 (+)	NCBI	ChiLan1.0	ChiLan1.0

GATM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	15	38,778,402 - 38,795,861 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	24,309,045 - 24,326,673 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	42,639,597 - 42,657,209 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	42,639,597 - 42,657,209 (-)	Ensembl	panpan1.1		panPan2

GATM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	11,724,446 - 11,742,214 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	11,723,519 - 11,742,214 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	30	11,861,543 - 11,879,299 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	11,859,577 - 11,879,307 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	11,782,971 - 11,800,732 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	11,889,472 - 11,907,009 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	12,009,534 - 12,027,312 (-)	NCBI		UU_Cfam_GSD_1.0

Gatm
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	90,169,547 - 90,184,640 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	8,017,603 - 8,032,703 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	8,017,611 - 8,032,703 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GATM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	126,361,945 - 126,380,871 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	126,361,968 - 126,378,705 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	140,845,025 - 140,861,764 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GATM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	37,836,207 - 37,853,811 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	37,836,335 - 37,852,822 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	103,208,357 - 103,226,225 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gatm
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	13,941,049 - 13,955,461 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	13,941,084 - 13,954,910 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gatm
135 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	597
Count of miRNA genes:	268
Interacting mature miRNAs:	330
Transcripts:	ENSRNOT00000000181
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat

Markers in Region

RH134360

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	109,659,072 - 109,659,272 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	114,711,724 - 114,711,923	NCBI	Rnor6.0
Rnor_5.0	3	121,249,861 - 121,250,060	UniSTS	Rnor5.0
Celera	3	108,536,295 - 108,536,494	UniSTS
RH 3.4 Map	3	965.7	UniSTS
Cytogenetic Map	3	q35	UniSTS

RH142307

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	109,659,072 - 109,659,273 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	114,711,724 - 114,711,924	NCBI	Rnor6.0
Rnor_5.0	3	121,249,861 - 121,250,061	UniSTS	Rnor5.0
Celera	3	108,536,295 - 108,536,495	UniSTS
RH 3.4 Map	3	965.7	UniSTS
Cytogenetic Map	3	q35	UniSTS

BG377645

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	109,662,293 - 109,663,051 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	114,714,945 - 114,715,702	NCBI	Rnor6.0
Rnor_5.0	3	121,253,082 - 121,253,839	UniSTS	Rnor5.0
Celera	3	108,540,216 - 108,540,973	UniSTS
Celera	3	108,539,516 - 108,540,973	UniSTS
RH 3.4 Map	3	956.2	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High										9
Medium		32	31	31	10	31	2	2	68	24	41	11	2
Low	3	11	26	10	9	10	6	9	6	2			6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY625271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U07971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000000181 ⟹ ENSRNOP00000000181

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	109,658,951 - 109,684,129 (-)	Ensembl
Rnor_6.0 Ensembl	3	114,711,562 - 114,728,410 (-)	Ensembl

RefSeq Acc Id:

NM_031031 ⟹ NP_112293

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	109,658,919 - 109,675,508 (-)	NCBI
Rnor_6.0	3	114,711,570 - 114,728,155 (-)	NCBI
Rnor_5.0	3	121,249,707 - 121,266,292 (-)	NCBI
RGSC_v3.4	3	109,558,043 - 109,565,432 (-)	RGD
Celera	3	108,536,141 - 108,553,426 (-)	RGD

Sequence:

show sequence

CGCGAGCTTGGCGACTAGGACCTTGTGCACACAGAGCAGCAGCAGAAACCGGGGCGATGCTACG
GGTGCGGTGTCTGCGCGGCGGCAGCCGAGGCGCCGAGGCGGTGCACTACATCGGCTCTCGGCTT
GGAGGATCCTTAACAGGATGGGTGCAGCGAACTTTCCAGAGCACCCAGGCAGCTACAGCTTCCT
CCCAAAATTCCTGTGCAGCTGAAGACAAGGCCACCCACCCCCTGCCCAAGGACTGCCCTGTCTC
CTCTTACAACGAATGGGACCCTTTAGAGGAAGTGATAGTGGGCAGAGCTGAAAATGCCTGTGTC
CCACCATTCACAGTGGAGGTGAAGGCCAATACATATGAAAAGTACTGGCCGTTTTACCAGAAAA
ATGGAGGTCTTTATTTTCCCAAAGATCATCTGAAGAAGGCTGTTGCCGAGGTCGAAGAGATGTG
CAATATTTTATCAATGGAAGGCGTGACCGTGAAGCGGCCTGACCCCATTGACTGGTCACTGAAG
TATAAGACTCCTGATTTTGAGTCTACAGGTTTATACAGCGCGATGCCTCGAGACATCCTGATGG
TTGTGGGGAATGAGATTATAGAGGCTCCCATGGCATGGCGCTCACGCTTCTTTGAGTACCGCGC
ATACAGGTCAATTATCAAAGACTACTTCCACCGTGGTGCCAAGTGGACAACGGCCCCCAAGCCC
ACAATGGCTGACGAACTGTATGACCAGGACTATCCCATCCATTCTGTGGAAGACAGACACAAAT
TGGCCGCTCAGGGGAAGTTCGTGACAACCGAGTTCGAGCCTTGCTTTGATGCTGCTGACTTCAT
TCGAGCTGGAAGAGATATTTTTGCGCAGAGAAGCCAGGTTACAAACTACCTGGGCATCGAGTGG
ATGCGTAGGCATCTTGCCCCAGACTACAGAGTGCATATCATCTCGTTTAAAGACCCCAATCCAA
TGCATATTGATGCCACCTTCAACATCATTGGACCTGGTCTTGTGCTCTCCAACCCTGACCGTCC
ATGCCATCAGATTGATCTTTTCAAGAAAGCAGGATGGACCATAGTTACCCCTCCAACACCTGTG
ATCCCCGATGATCATCCCCTCTGGATGTCATCCAAGTGGCTCTCCATGAATGTCTTAATGCTAG
ATGAGAAGCGCGTGATGGTAGACGCCAATGAGGTCCCAATTCAGAAGATGTTTGAGAAGCTGGG
TATCAGCACCATTAAGGTTAACATTCGAAATGCCAATTCCCTGGGAGGAGGCTTCCACTGCTGG
ACCTGCGACGTCCGCCGCCGAGGCACCCTTCAGTCCTACTTTGACTGAGCGGCCGTGGTGTGGC
TTGGGGCATAGCCTCAGATATACCTAAGAAGCAGCAAGGCCCTTCTCTCGCTTTAATAAATGCA
TGAACTGTAGTGCTTTGAACAATCACCTCCTTAACAGGGTTCCCAAACCTGGGTTACTTTTCGT
TGACATAAGGAAGATAACTTTTGATAGGTCTTACTTTCTTCTCCTAAAGTTATTTACAATTTGG
CTTCAAATATAAAAGTTGAGTAAATGTATACCAGGGCAGAAATTAGTCATTTGAGTAACTTGGC
CGCTAATATTTAACCATCTACCTCTGTTTTTAATCTTCTTTCCTAAAGGCAGCTTGAAATGTCG
GTCCTAACCTTGTCTTCTTTTCCTCTCTGGTGGACTTGTGAATGTTCATATTACTTCAAAGACT
TAGGAGAAAAACACAGACCCTAAGTAGAACCAGATATTTGTCTATTTTTCAAAAATAATTGGAT
GTTTTTTAAAATTTTGTTTTTAAATAACCTAGACTATGCAAACACTGGAAAAAAAATGAAGTAA
CTTTTCCATGAATGCTTTTAACATTCTTGTGTCACCATTTGGTACTAAACTCTAGTCCTGCCTC
TTACCTCATTTCAAGTGGGTTTTCCTTCCTTCCTTCCTTCCTTCCTTCCTCCCTTCCTTCTTTC
CTTCCTTTCTTCCAAAAACTTAGAGAAGTGCTTGGTTTAATAGAGTGAAACTTGTAGATCCTAT
TCCTAAAGGTTGATGATGTTCAGTATCTAACAGGTAAAATGGCATCTTTGTTAATCTGTCTTGT
TTACATATATGCAAATTATTTAAGGCATAGAGTTTTGAAGCATTTTTTAAAAACTAATGCAGGT
AAAAGAAATACATGTGACATGAAATAATTTTAATGTTGGATATTGTATATGTATTTTTATTCTA
ATAAACTTTTGTGTTCCAGATTGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112293	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA21250	(Get FASTA)	NCBI Sequence Viewer
	AAH81785	(Get FASTA)	NCBI Sequence Viewer
	AAT39897	(Get FASTA)	NCBI Sequence Viewer
	EDL80041	(Get FASTA)	NCBI Sequence Viewer
	P50442	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112293 ⟸ NM_031031
- Peptide Label:	precursor
- UniProtKB:	Q6ITZ7 (UniProtKB/Swiss-Prot), P50442 (UniProtKB/Swiss-Prot), A6HPT9 (UniProtKB/TrEMBL), A0A140TA89 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRVRCLRGGSRGAEAVHYIGSRLGGSLTGWVQRTFQSTQAATASSQNSCAAEDKATHPLPKDC PVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPKDHLKKAVAEVE EMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFE YRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAA DFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGLVLSNP DRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFE KLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD hide sequence

RefSeq Acc Id:

ENSRNOP00000000181 ⟸ ENSRNOT00000000181

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50442-F1-model_v2	AlphaFold	P50442	1-423	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71090	AgrOrtholog
BioCyc Gene	G2FUF-48090	BioCyc
BioCyc Pathway	GLYCGREAT-PWY [creatine biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000000168	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000000181	ENTREZGENE
	ENSRNOP00000000181.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000181	ENTREZGENE
	ENSRNOT00000000181.5	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7132560	IMAGE-MGC_LOAD
InterPro	AmidinoTrfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81660	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93388	IMAGE-MGC_LOAD
NCBI Gene	81660	ENTREZGENE
PANTHER	GLYCINE AMIDINOTRANSFERASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10488	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gatm	PhenoGen
Superfamily-SCOP	Pentein	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A140TA89	ENTREZGENE, UniProtKB/TrEMBL
	A6HPT9	ENTREZGENE, UniProtKB/TrEMBL
	GATM_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6ITZ7	ENTREZGENE
UniProt Secondary	Q6ITZ7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-20	Gatm	glycine amidinotransferase	Gatm	glycine amidinotransferase (L-arginine:glycine amidinotransferase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Gatm	glycine amidinotransferase (L-arginine:glycine amidinotransferase)			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	protein localized to mitochondrial membrane	70746
gene_expression	mRNA found in significant amounts only in kidney and pancreas	70746
gene_homology	protein shares 37% aa identity with yeast (S. griseus) amidinotranserase	70746
gene_regulation	mRNA epxression may be regulated by creatine and/or growth hormone	70746

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)