Advanced Search (OLGA)

Gene: Vgf (VGF nerve growth factor inducible) Rattus norvegicus

Analyze

Symbol:

Vgf

Name:

VGF nerve growth factor inducible

RGD ID:

69399

Description:

Predicted to enable neuropeptide hormone activity. Involved in regulation of neuronal synaptic plasticity and synaptic signaling via neuropeptide. Located in neuronal cell body. Is active in glutamatergic synapse. Orthologous to human VGF (VGF nerve growth factor inducible); INTERACTS WITH (+)-pilocarpine; 1,3,5-trinitro-1,3,5-triazinane; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100909521; neurosecretory protein VGF; neurosecretory protein VGF-like; VGF8a protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VGF (VGF nerve growth factor inducible)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Vgf (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vgf (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VGF (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VGF (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vgf (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VGF (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VGF (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vgf (VGF nerve growth factor inducible)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	VGF (VGF nerve growth factor inducible)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vgf (VGF nerve growth factor inducible)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vgf (VGF nerve growth factor inducible)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	si:dkey-175g6.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	25,274,004 - 25,281,803 (-)	NCBI		GRCr8
mRatBN7.2	12	19,637,313 - 19,645,123 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	19,637,320 - 19,640,341 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	20,774,908 - 20,777,923 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	21,387,621 - 21,390,636 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	20,452,159 - 20,455,174 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	22,677,302 - 22,680,630 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	22,677,607 - 22,680,630 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	24,689,881 - 24,692,911 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	20,903,304 - 20,906,327 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	20,892,915 - 20,895,939 (+)	NCBI
Celera	12	21,412,983 - 21,416,003 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

gastric ulcer (ISO)

Hyperphagia (ISO)

obesity (ISO)

Plasminogen Activator Inhibitor-1 Deficiency (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

1,3,5-trinitro-1,3,5-triazinane (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-sulfonyldiphenol (EXP)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carmustine (ISO)

choline (ISO)

cisplatin (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

crocin-1 (EXP)

diquat (ISO)

disulfiram (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

ethanol (ISO)

fentanyl (EXP)

fluoxetine (ISO)

folic acid (ISO)

formaldehyde (ISO)

gemcitabine (ISO)

genistein (EXP)

gentamycin (EXP)

graphite (EXP)

hydrogen chloride (ISO)

indometacin (EXP)

L-methionine (ISO)

lead diacetate (ISO)

lead(0) (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

linsidomine (EXP)

lipopolysaccharide (ISO)

manganese(II) chloride (ISO)

mercaptopurine (EXP)

methamphetamine (EXP)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

niclosamide (ISO)

ozone (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

paroxetine (ISO)

pentanal (ISO)

propanal (ISO)

prostaglandin E2 (EXP)

purine-6-thiol (EXP)

reserpine (EXP)

rotenone (ISO)

S-nitrosoglutathione (ISO)

SB 431542 (ISO)

scopolamine (EXP)

selenium atom (ISO)

serpentine asbestos (ISO)

sodium arsenite (ISO)

Soman (EXP)

sotorasib (ISO)

thapsigargin (EXP,ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vitamin E (ISO)

zalcitabine (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate homeostasis (IBA)

generation of precursor metabolites and energy (ISO)

glucose homeostasis (ISO)

insulin secretion (ISO)

modulation of chemical synaptic transmission (EXP,IDA)

neuron differentiation (TAS)

ovarian follicle development (ISO)

regulation of neuronal synaptic plasticity (IDA)

regulation of synaptic plasticity (IBA)

response to cAMP (ISO)

response to cold (ISO)

response to dietary excess (ISO)

response to insulin (ISO)

signal transduction (IEA)

synaptic signaling via neuropeptide (EXP,IDA)

Cellular Component

cytoplasmic vesicle (IEA,ISO)

extracellular region (IEA)

extracellular space (IBA,ISO)

glutamatergic synapse (EXP,IDA)

Golgi apparatus (ISO)

neuronal cell body (IDA)

synapse (EXP,IDA)

transport vesicle (IEA)

Molecular Function

growth factor activity (IEA)

hormone activity (IBA)

neuropeptide hormone activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Brain-derived neurotrophic factor-induced gene expression reveals novel actions of VGF in hippocampal synaptic plasticity.	Alder J, etal., J Neurosci. 2003 Nov 26;23(34):10800-8.
2.	A prohormone convertase cleavage site within a predicted alpha-helix mediates sorting of the neuronal and endocrine polypeptide VGF into the regulated secretory pathway.	Garcia AL, etal., J Biol Chem. 2005 Dec 16;280(50):41595-608. Epub 2005 Oct 12.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	NGF induces the expression of the VGF gene through a cAMP response element.	Hawley RJ, etal., J Neurosci 1992 Jul;12(7):2573-81.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Structure of the gene encoding VGF, a nervous system-specific mRNA that is rapidly and selectively induced by nerve growth factor in PC12 cells.	Salton SR, etal., Mol Cell Biol 1991 May;11(5):2335-49.
11.	Pro-VGF-derived peptides induce penile erection in male rats: possible involvement of oxytocin.	Succu S, etal., Eur J Neurosci. 2004 Dec;20(11):3035-40.
12.	Molecular constituents of the postsynaptic density fraction revealed by proteomic analysis using multidimensional liquid chromatography-tandem mass spectrometry.	Yoshimura Y, etal., J Neurochem. 2004 Feb;88(3):759-68.

Additional References at PubMed

PMID:2676516	PMID:10381005	PMID:10433265	PMID:12177191	PMID:15051509	PMID:15706611	PMID:16141392	PMID:16631141	PMID:16983076	PMID:17440014	PMID:18059283	PMID:19077191
PMID:19466987	PMID:20524965	PMID:20876237	PMID:23485923	PMID:23541636	PMID:24106277	PMID:25002582	PMID:25280008	PMID:25569790	PMID:30371765	PMID:33245952	PMID:35594706

Genomics

Comparative Map Data

Vgf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	25,274,004 - 25,281,803 (-)	NCBI		GRCr8
mRatBN7.2	12	19,637,313 - 19,645,123 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	19,637,320 - 19,640,341 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	20,774,908 - 20,777,923 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	21,387,621 - 21,390,636 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	20,452,159 - 20,455,174 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	22,677,302 - 22,680,630 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	22,677,607 - 22,680,630 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	24,689,881 - 24,692,911 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	20,903,304 - 20,906,327 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	20,892,915 - 20,895,939 (+)	NCBI
Celera	12	21,412,983 - 21,416,003 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

VGF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	101,162,509 - 101,169,952 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	101,162,509 - 101,165,569 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	100,805,790 - 100,808,850 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	100,592,517 - 100,595,572 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	100,399,231 - 100,402,287	NCBI
Celera	7	95,814,146 - 95,817,208 (-)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	95,398,955 - 95,401,959 (-)	NCBI		HuRef
CHM1_1	7	100,736,252 - 100,739,314 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	102,485,258 - 102,492,805 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	100,164,177 - 100,167,239 (-)	NCBI

Vgf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	137,054,156 - 137,062,205 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	137,055,246 - 137,062,205 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	137,025,301 - 137,033,351 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	137,026,392 - 137,033,351 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	137,506,165 - 137,509,221 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	137,314,922 - 137,317,978 (+)	NCBI		MGSCv36	mm8
Celera	5	134,047,034 - 134,050,090 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.13	NCBI

Vgf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	16,119,073 - 16,126,968 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	16,119,073 - 16,126,968 (+)	NCBI	ChiLan1.0	ChiLan1.0

VGF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	119,174,833 - 119,177,792 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	167,439,463 - 167,442,422 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	93,302,956 - 93,307,892 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	106,544,544 - 106,549,329 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

VGF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	8,701,289 - 8,704,386 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	8,700,667 - 8,704,397 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	10,398,631 - 10,401,711 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	8,520,838 - 8,523,920 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	8,520,536 - 8,523,897 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	8,480,897 - 8,483,981 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	8,451,358 - 8,454,443 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	8,616,024 - 8,619,109 (+)	NCBI		UU_Cfam_GSD_1.0

Vgf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	132,969,254 - 132,977,238 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	1,059,799 - 1,061,646 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	1,059,292 - 1,062,384 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VGF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	8,888,506 - 8,891,601 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	8,888,502 - 8,891,399 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

VGF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	12,016,216 - 12,021,151 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	12,018,800 - 12,020,647 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	4,329,143 - 4,332,216 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vgf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	16,105,227 - 16,109,905 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	16,105,187 - 16,109,922 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Vgf
32 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	223
Count of miRNA genes:	150
Interacting mature miRNAs:	163
Transcripts:	ENSRNOT00000041808
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	15025183	20794014	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

D12Rat70

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	19,642,166 - 19,642,312 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	22,682,228 - 22,682,373	NCBI	Rnor6.0
Rnor_5.0	12	24,694,509 - 24,694,654	UniSTS	Rnor5.0
RGSC_v3.4	12	20,901,332 - 20,901,478	RGD	RGSC3.4
RGSC_v3.4	12	20,901,333 - 20,901,478	UniSTS	RGSC3.4
RGSC_v3.1	12	20,890,916 - 20,891,241	RGD
Celera	12	21,417,829 - 21,417,974	UniSTS
SHRSP x BN Map	12	22.74	UniSTS
SHRSP x BN Map	12	22.74	RGD
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	111	35	25	9	10	9	6	61	37	91	6	43	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001395575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_030997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M60522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M60525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M74223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000041808 ⟹ ENSRNOP00000050024

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	19,637,320 - 19,640,341 (-)	Ensembl
Rnor_6.0 Ensembl	12	22,677,607 - 22,680,630 (-)	Ensembl

RefSeq Acc Id:

NM_001395575 ⟹ NP_001382504

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	25,274,004 - 25,277,020 (-)	NCBI
mRatBN7.2	12	19,637,313 - 19,640,329 (-)	NCBI

RefSeq Acc Id:

NM_030997 ⟹ NP_112259

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	25,274,004 - 25,277,020 (-)	NCBI
mRatBN7.2	12	19,637,313 - 19,640,329 (-)	NCBI
Rnor_6.0	12	22,677,607 - 22,680,630 (-)	NCBI
Rnor_5.0	12	24,689,881 - 24,692,911 (-)	NCBI
RGSC_v3.4	12	20,903,304 - 20,906,327 (+)	RGD
Celera	12	21,412,983 - 21,416,003 (-)	RGD

Sequence:

show sequence

CAGCGTGCTGAAGCCGGAGCGAGAGCGCTGTTGCTGACCCAGCTGAGCCCAGCTCCTAGGACGC
CAGCCCTCGACCATCTTTCATACTCCAGCCACGGAACGGAGCCAGGGCAGACGGGTCCGGATTT
TCCCCCTGCCCCGACCCTCCTCTCCACCTCCCGCCGTCGTGACACCGGCTGGGGGCGACAGGAG
GCACTGGGTACCCAGAACGAGGATTGCGAGCGTTCTCTGACCATTTGCACGACCCCAGAGATTG
CCACATCTTTCTTGTTCTCTGCTAAACGTTTCTCTTCGGAGTCTCTGGCAGCCCGTTGGTCATG
AAAACCTTCACGTTGCCAGCATCCGTCCTCTTCTGCTTCCTTCTACTCATCCGGGGGTTGGGAG
CAGCACCCCCCGGGCGCTCCGATGTTTATCCTCCTCCCCTCGGCTCTGAGCATAATGGGCAGGT
AGCTGAGGACGCAGTGTCCCGGCCAAAGGATGACAGCGTCCCAGAGGTCCGAGCGGCTCGGAAT
TCCGAGCCTCAGGACCAGGGAGAGCTCTTCCAGGGCGTGGATCCCCGGGCGCTGGCCGCGGTAC
TGTTGCAGGCACTGGACCGTCCGGCCTCGCCCCCGGCTGTCCCGGCAGGTTCCCAGCAGGGAAC
ACCCGAAGAAGCAGCAGAAGCTCTGCTGACCGAGTCCGTGCGCAGTCAGACCCATAGCCTCCCG
GCATCAGAAATCCAAGCGTCCGCTGTGGCGCCCCCTCGCCCTCAGACTCAGGACAACGATCCCG
AGGCAGACGACCGCTCAGAAGAGCTGGAGGCACTAGCATCCTTGCTCCAAGAACTTCGAGATTT
CAGTCCGAGTAATGCTAAGCGCCAGCAAGAGACGGCGGCAGCAGAGACTGAAACCCGCACGCAC
ACGCTGACCCGAGTCAATCTGGAGAGCCCCGGGCCAGAGCGCGTATGGCGCGCTTCCTGGGGAG
AGTTCCAGGCGCGCGTCCCGGAGCGTGCTCCTCTGCCGCCCTCGGTCCCTTCTCAATTCCAGGC
TCGAATGTCCGAAAACGTTCCCCTTCCCGAAACCCATCAGTTCGGGGAAGGAGTGTCCTCCCCT
AAAACACATCTTGGTGAGACTTTGACACCCTTATCCAAGGCGTACCAAAGTCTAAGTGCCCCCT
TCCCCAAGGTGCGTCGGCTCGAGGGCTCATTCCTGGGCGGTTCCGAGGCAGGAGAGCGCCTGCT
TCAACAAGGGTTAGCTCAGGTAGAGGCAGGGAGGAGGCAGGCGGAGGCCACCCGGCAGGCCGCA
GCGCAAGAAGAGCGGCTGGCCGATCTCGCCTCCGACCTGCTGCTCCAGTATTTGCTGCAGGGCG
GCGCCCGGCAGCGCGATCTCGGGGGTCGCGGGCTGCAGGAGACGCAGCAAGAGCGGGAGAACGA
GAGGGAGGAGGAGGCGGAGCAGGAGAGACGCGGTGGTGGGGAGGACGAGGTGGGGGAAGAGGAT
GAGGAGGCGGCAGAGGCGGAGGCGGAGGCAGAGGAGGCGGAGAGGGCGCGGCAGAACGCGCTCC
TGTTCGCCGAGGAGGAGGACGGGGAAGCCGGAGCCGAGGACAAGCGCTCCCAGGAGGAGGCGCC
AGGCCATCGGCGGAAGGATGCTGAGGGGACAGAGGAGGGCGGGGAGGAGGATGACGACGACGAA
GAGATGGATCCGCAGACGATCGATAGTCTCATTGAACTGTCCACCAAACTCCACCTGCCAGCAG
ACGATGTGGTCAGCATCATCGAAGAGGTGGAGGAGAAACGGAAGCGGAAGAAGAACGCCCCTCC
CGAGCCGGTGCCGCCCCCCAGGGCTGCCCCAGCCCCGACCCATGTCCGCTCCCCGCAGCCCCCA
CCTCCCGCCCCGGCCCGGGATGAGTTGCCGGACTGGAACGAAGTACTCCCACCCTGGGATCGGG
AGGAGGATGAGGTGTTTCCCCCGGGGCCCTATCACCCCTTCCCAAACTACATTCGGCCGCGGAC
ACTGCAGCCGCCCGCATCCTCCCGCCGCCGTCACTTCCATCACGCGTTGCCACCTGCGCGCCAC
CATCCCGATCTGGAGGCCCAGGCCAGGCGCGCGCAGGAGGAAGCGGACGCGGAGGAGCGCCGGC
TGCAGGAGCAGGAGGAGCTGGAGAATTACATTGAGCACGTGCTGCTGCACCGCCCGTGACCCGC
CCCTGCGCGCCCGCTCCCAACTGCGCGCGCCGCCACGCCCCCCCTCCGTGTCGCTCCTCCTCCC
TCTCGGTGTTTGCATGCGCCCCGGCTCCGCCCCTCGGCTGCCGCCCGGCCCCGCCCCACAAGGC
CCCGCCCCGGGTTCTGTCAGGACCAGACCTGTCAGACTTCTTTGGGGTCTGATCCTGGGGCCAG
CCCAGGCGGGTGTGTGGTTTGTGCGAGTCCCCTTACACCCCCACTTCCTCCAGGGGCCTCGTCC
CCATCTAGTTTCTCTAGCGACTTCCTGGTCCCAAACGGGGAAAAGCTGTTCTATTTAATCGTGT
GAAGTGTCTGTCTCCCAGCCTTGGGGCCCCCGGAGCCTCCCTTCTCCAAATTGCTGTGAACTTA
CCCACATCTTGCCCTTCTGTTGTAAATACCCCTCACGGAGGAAATAGTTTTGCTAAGAAATAAA
AGTGACTATTTT

hide sequence

RefSeq Acc Id:

XM_039089290 ⟹ XP_038945218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	25,274,004 - 25,281,803 (-)	NCBI
mRatBN7.2	12	19,637,313 - 19,645,123 (-)	NCBI

RefSeq Acc Id:

XM_039089291 ⟹ XP_038945219

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	25,274,004 - 25,281,677 (-)	NCBI
mRatBN7.2	12	19,637,313 - 19,644,985 (-)	NCBI

RefSeq Acc Id:

XM_039089294 ⟹ XP_038945222

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	25,274,004 - 25,281,803 (-)	NCBI
mRatBN7.2	12	19,637,313 - 19,645,123 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001382504	(Get FASTA)	NCBI Sequence Viewer
	NP_112259	(Get FASTA)	NCBI Sequence Viewer
	XP_038945218	(Get FASTA)	NCBI Sequence Viewer
	XP_038945219	(Get FASTA)	NCBI Sequence Viewer
	XP_038945222	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41700	(Get FASTA)	NCBI Sequence Viewer
	AAA42336	(Get FASTA)	NCBI Sequence Viewer
	AAA86428	(Get FASTA)	NCBI Sequence Viewer
	EDM13291	(Get FASTA)	NCBI Sequence Viewer
	EDM13292	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050024
	ENSRNOP00000050024.3
	ENSRNOP00000104281
GenBank Protein	P20156	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112259 ⟸ NM_030997
- Peptide Label:	precursor
- UniProtKB:	P20156 (UniProtKB/Swiss-Prot), A6J052 (UniProtKB/TrEMBL), F1LP80 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKTFTLPASVLFCFLLLIRGLGAAPPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAAR NSEPQDQGELFQGVDPRALAAVLLQALDRPASPPAVPAGSQQGTPEEAAEALLTESVRSQTHSL PASEIQASAVAPPRPQTQDNDPEADDRSEELEALASLLQELRDFSPSNAKRQQETAAAETETRT HTLTRVNLESPGPERVWRASWGEFQARVPERAPLPPSVPSQFQARMSENVPLPETHQFGEGVSS PKTHLGETLTPLSKAYQSLSAPFPKVRRLEGSFLGGSEAGERLLQQGLAQVEAGRRQAEATRQA AAQEERLADLASDLLLQYLLQGGARQRDLGGRGLQETQQERENEREEEAEQERRGGGEDEVGEE DEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRSQEEAPGHRRKDAEGTEEGGEEDDDD EEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEPVPPPRAAPAPTHVRSPQP PPPAPARDELPDWNEVLPPWDREEDEVFPPGPYHPFPNYIRPRTLQPPASSRRRHFHHALPPAR HHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP hide sequence

Ensembl Acc Id:

ENSRNOP00000050024 ⟸ ENSRNOT00000041808

RefSeq Acc Id:	XP_038945222 ⟸ XM_039089294
- Peptide Label:	isoform X1
- UniProtKB:	F1LP80 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945218 ⟸ XM_039089290
- Peptide Label:	isoform X1
- UniProtKB:	F1LP80 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945219 ⟸ XM_039089291
- Peptide Label:	isoform X1
- UniProtKB:	F1LP80 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001382504 ⟸ NM_001395575
- Peptide Label:	precursor
- UniProtKB:	P20156 (UniProtKB/Swiss-Prot), A6J052 (UniProtKB/TrEMBL), F1LP80 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20156-F1-model_v2	AlphaFold	P20156	1-617	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698527

Promoter ID:

EPDNEW_R9051

Type:

single initiation site

Name:

Vgf_1

Description:

VGF nerve growth factor inducible

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	22,680,629 - 22,680,689	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69399	AgrOrtholog
BioCyc Gene	G2FUF-19676	BioCyc
Ensembl Genes	ENSRNOG00000001416	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000041808	ENTREZGENE
	ENSRNOT00000041808.3	UniProtKB/Swiss-Prot
	ENSRNOT00000155118	ENTREZGENE
InterPro	VGF	UniProtKB/Swiss-Prot
KEGG Report	rno:29461	UniProtKB/Swiss-Prot
NCBI Gene	29461	ENTREZGENE
PANTHER	NEUROSECRETORY PROTEIN VGF	UniProtKB/Swiss-Prot
	PTHR15159	UniProtKB/Swiss-Prot
PhenoGen	Vgf	PhenoGen
RatGTEx	ENSRNOG00000001416	RatGTEx
UniProt	A6J052	ENTREZGENE, UniProtKB/TrEMBL
	F1LP80	ENTREZGENE, UniProtKB/TrEMBL
	P20156	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Vgf	VGF nerve growth factor inducible	LOC100909521	neurosecretory protein VGF-like	Data merged from RGD:6503411	737654	PROVISIONAL
2012-07-05	LOC100909521	neurosecretory protein VGF-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Vgf	VGF nerve growth factor inducible			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains TATAA and CCAAT elements, several GC boxes, and a consensus cAMP response element binding protein (CREB) binding site	69396
gene_expression	mRNA expressed in central and peripheral nervous system tissue	69396
gene_regulation	gene induction regulated by neuronal growth factor (NGF) and cAMP-mediated agents	730082

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD