Sox11 (SRY-box transcription factor 11)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sox11 (SRY-box transcription factor 11) Rattus norvegicus

Analyze

Symbol:

Sox11

Name:

SRY-box transcription factor 11

RGD ID:

69351

Description:

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and transcription cis-regulatory region binding activity. Involved in several processes, including negative regulation of transcription regulatory region DNA binding activity; neurogenesis; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome 9. Orthologous to human SOX11 (SRY-box transcription factor 11); INTERACTS WITH 6-propyl-2-thiouracil; alachlor; amitriptyline.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

SRY (sex determining region Y)-box 11; SRY box 11; SRY-box 11; SRY-box containing gene 11; transcription factor SOX-11

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SOX11 (SRY-box transcription factor 11)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sox11 (SRY (sex determining region Y)-box 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sox11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SOX11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SOX11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sox11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SOX11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SOX11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sox11 (SRY-box transcription factor 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SOX11 (SRY-box transcription factor 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sox11 (SRY (sex determining region Y)-box 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sox11b (SRY (sex determining region Y)-box 11b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sox11a (SRY (sex determining region Y)-box 11a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sem-2	Alliance	DIOPT (PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sox14	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	sox-4	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	44,008,333 - 44,010,354 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	44,008,340 - 44,010,354 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	44,315,859 - 44,317,880 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	44,630,739 - 44,632,760 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	44,063,910 - 44,065,931 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	46,629,967 - 46,631,988 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	46,629,974 - 46,631,983 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	55,343,067 - 55,345,088 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	45,141,366 - 45,143,387 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	45,144,498 - 45,146,513 (-)	NCBI
Celera	6	43,252,857 - 43,254,878 (-)	NCBI		Celera
Cytogenetic Map	6	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenoid cystic carcinoma (ISO)

Coffin-Siris syndrome (ISO)

Coffin-Siris syndrome 9 (ISO)

Craniosynostosis Syndrome, Autosomal Recessive (ISO)

genetic disease (ISO)

Neoplasm Invasiveness (ISO)

Pituitary Stalk Interruption Syndrome (ISO)

Salivary Gland Neoplasms (ISO)

Weissenbacher-Zweymuller syndrome (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

alachlor (EXP)

all-trans-retinoic acid (ISO)

amitriptyline (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

camptothecin (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chlorpyrifos (EXP)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

Cuprizon (EXP)

dexamethasone (EXP,ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

entinostat (ISO)

flavonoids (EXP)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

graphite (EXP)

hydroquinone (ISO)

ketamine (EXP)

L-ascorbic acid (EXP)

L-methionine (ISO)

linalool (EXP)

methylphenidate (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP)

PCB138 (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

progesterone (ISO)

Ptaquiloside (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (EXP)

temozolomide (ISO)

testosterone (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

cardiac ventricle formation (ISO)

cell population proliferation (IEP)

closure of optic fissure (ISO,ISS)

cornea development in camera-type eye (ISO,ISS)

embryonic digestive tract morphogenesis (ISO,ISS)

embryonic skeletal system morphogenesis (ISO,ISS)

eyelid development in camera-type eye (ISO,ISS)

glial cell development (ISO)

glial cell proliferation (ISO,ISS)

hard palate development (ISO,ISS)

kidney development (IEP)

lens morphogenesis in camera-type eye (ISO,ISS)

limb bud formation (ISO)

lung morphogenesis (ISO,ISS)

negative regulation of cell death (ISO)

negative regulation of gene expression (ISO,ISS)

negative regulation of glial cell proliferation (ISO,ISS)

negative regulation of lymphocyte proliferation (ISO)

negative regulation of transcription by RNA polymerase II (IBA,ISO,ISS)

negative regulation of transcription regulatory region DNA binding (IMP)

nervous system development (ISS)

neural crest cell development (ISO)

neural tube formation (ISO)

neuroepithelial cell differentiation (ISO,ISS)

neuron differentiation (IBA,ISO)

noradrenergic neuron differentiation (IMP,ISO)

oligodendrocyte development (IEP)

outflow tract morphogenesis (ISO,ISS)

positive regulation of BMP signaling pathway (ISO,ISS)

positive regulation of cell population proliferation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of gene expression (ISO,ISS)

positive regulation of hippo signaling (ISO,ISS)

positive regulation of hormone secretion (ISO,ISS)

positive regulation of lens epithelial cell proliferation (ISO,ISS)

positive regulation of neurogenesis (ISO,ISS)

positive regulation of neuron differentiation (ISO,ISS)

positive regulation of ossification (ISO,ISS)

positive regulation of osteoblast differentiation (ISO,ISS)

positive regulation of stem cell proliferation (ISO,ISS)

positive regulation of transcription by RNA polymerase II (IBA,IMP,ISO,ISS)

regulation of transforming growth factor beta receptor signaling pathway (ISO)

skeletal muscle cell differentiation (ISO)

skeletal system development (ISO)

soft palate development (ISO,ISS)

somite development (ISO)

spinal cord development (ISO,ISS)

sympathetic nervous system development (ISO,ISS)

ventricular septum morphogenesis (ISO,ISS)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IDA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

cis-regulatory region sequence-specific DNA binding (ISO,ISS)

DNA binding (ISO,TAS)

DNA-binding transcription activator activity, RNA polymerase II-specific (IBA,IDA,ISO)

DNA-binding transcription factor activity (IDA,ISO,ISS)

protein binding (IPI)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

transcription cis-regulatory region binding (IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The helix-loop-helix inhibitor of differentiation (ID) proteins induce post-mitotic terminally differentiated Sertoli cells to re-enter the cell cycle and proliferate.	Chaudhary J, etal., Biol Reprod. 2005 May;72(5):1205-17. Epub 2005 Jan 12.
2.	The three SoxC proteins--Sox4, Sox11 and Sox12--exhibit overlapping expression patterns and molecular properties.	Dy P, etal., Nucleic Acids Res. 2008 May;36(9):3101-17. doi: 10.1093/nar/gkn162. Epub 2008 Apr 10.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	The Optimedin gene is a downstream target of Pax6.	Grinchuk O, etal., J Biol Chem. 2005 Oct 21;280(42):35228-37. Epub 2005 Aug 22.
6.	Cooperative function of POU proteins and SOX proteins in glial cells.	Kuhlbrodt K, etal., J Biol Chem 1998 Jun 26;273(26):16050-7.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Mesenchymal-epithelial transition in the developing metanephric kidney: gene expression study by differential display.	Plisov SY, etal., Genesis. 2000 May;27(1):22-31.
9.	Sequential requirement of Sox4 and Sox11 during development of the sympathetic nervous system.	Potzner MR, etal., Development. 2010 Mar;137(5):775-84. doi: 10.1242/dev.042101.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Fibroblast growth factor-inducible-14 is induced in axotomized neurons and promotes neurite outgrowth.	Tanabe K, etal., J Neurosci. 2003 Oct 22;23(29):9675-86.
13.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.	Identification of novel domains within Sox-2 and Sox-11 involved in autoinhibition of DNA binding and partnership specificity.	Wiebe MS, etal., J Biol Chem. 2003 May 16;278(20):17901-11. Epub 2003 Mar 10.

Additional References at PubMed

PMID:10574465	PMID:10606637	PMID:15254231	PMID:15456859	PMID:17934069	PMID:18261853	PMID:18423449	PMID:18505825	PMID:19490090	PMID:19808959	PMID:20596238	PMID:20624318
PMID:20626275	PMID:20646169	PMID:20847309	PMID:21124928	PMID:21527504	PMID:25466891	PMID:31916393	PMID:32935389

Genomics

Comparative Map Data

Sox11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	44,008,333 - 44,010,354 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	44,008,340 - 44,010,354 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	44,315,859 - 44,317,880 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	44,630,739 - 44,632,760 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	44,063,910 - 44,065,931 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	46,629,967 - 46,631,988 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	46,629,974 - 46,631,983 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	55,343,067 - 55,345,088 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	45,141,366 - 45,143,387 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	45,144,498 - 45,146,513 (-)	NCBI
Celera	6	43,252,857 - 43,254,878 (-)	NCBI		Celera
Cytogenetic Map	6	q16	NCBI

SOX11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	5,692,384 - 5,701,385 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	5,692,384 - 5,701,385 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	5,832,516 - 5,841,517 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	5,750,250 - 5,758,968 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	5,783,396 - 5,792,114	NCBI
Celera	2	5,748,512 - 5,756,851 (+)	NCBI		Celera
Cytogenetic Map	2	p25.2	NCBI
HuRef	2	5,676,397 - 5,685,112 (+)	NCBI		HuRef
CHM1_1	2	5,762,093 - 5,770,810 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	5,713,811 - 5,722,812 (+)	NCBI		T2T-CHM13v2.0

Sox11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	27,384,267 - 27,392,717 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	27,384,263 - 27,392,573 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	27,334,268 - 27,342,718 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	27,334,264 - 27,342,574 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	28,019,133 - 28,027,583 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	27,921,484 - 27,928,980 (-)	NCBI		MGSCv36	mm8
Celera	12	28,811,290 - 28,819,758 (-)	NCBI		Celera
Cytogenetic Map	12	A2	NCBI

Sox11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955487	2,679,145 - 2,680,521 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955487	2,678,961 - 2,680,869 (-)	NCBI	ChiLan1.0	ChiLan1.0

SOX11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	5,840,399 - 5,841,762 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	2A	5,699,738 - 5,711,210 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SOX11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	17	3,570,850 - 3,572,822 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	3,680,433 - 3,682,409 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	3,680,517 - 3,682,010 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	3,573,068 - 3,575,034 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	3,576,503 - 3,578,454 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	3,580,950 - 3,582,922 (+)	NCBI		UU_Cfam_GSD_1.0

Sox11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	9,632,081 - 9,635,331 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004937107	203,120 - 207,185 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SOX11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	129,798,854 - 129,800,197 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	129,797,438 - 129,800,568 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	138,751,621 - 138,754,531 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SOX11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	101,982,551 - 101,991,305 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	101,989,895 - 101,991,220 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	10,348,860 - 10,357,867 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sox11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624846	4,044,893 - 4,046,248 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624846	4,043,010 - 4,046,660 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sox11
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	263
Count of miRNA genes:	172
Interacting mature miRNAs:	196
Transcripts:	ENSRNOT00000045963
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	32074428	72227641	Rat
634318	Bw118	Body weight QTL 118	3.55		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight (CMO:0000088)	6	33309549	57730294	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	33309549	81132889	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	34434137	77102317	Rat
1354632	Scl29	Serum cholesterol level QTL 29	3.74		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	6	35098709	71636405	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	35230417	80230417	Rat
70199	Coreg1	Compensatory renal growth QTL 1	11.8		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	6	35691618	57730540	Rat
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	38783989	83783989	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat

Markers in Region

RH140068

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	44,008,807 - 44,009,003 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	46,630,442 - 46,630,637	NCBI	Rnor6.0
Rnor_5.0	6	55,343,542 - 55,343,737	UniSTS	Rnor5.0
RGSC_v3.4	6	45,141,841 - 45,142,036	UniSTS	RGSC3.4
Celera	6	43,253,332 - 43,253,527	UniSTS
RH 3.4 Map	6	263.2	UniSTS
Cytogenetic Map	6	q16	UniSTS

Sox11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	44,007,548 - 44,008,282 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	46,629,183 - 46,629,916	NCBI	Rnor6.0
Rnor_5.0	6	55,342,283 - 55,343,016	UniSTS	Rnor5.0
RGSC_v3.4	6	45,140,582 - 45,141,315	UniSTS	RGSC3.4
Celera	6	43,252,073 - 43,252,806	UniSTS
Cytogenetic Map	6	q16	UniSTS

PMC85614P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	44,009,144 - 44,009,797 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	46,630,779 - 46,631,431	NCBI	Rnor6.0
Rnor_5.0	6	55,343,879 - 55,344,531	UniSTS	Rnor5.0
RGSC_v3.4	6	45,142,178 - 45,142,830	UniSTS	RGSC3.4
Celera	6	43,253,669 - 43,254,321	UniSTS
Cytogenetic Map	6	q16	UniSTS

Sox11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	44,009,716 - 44,009,867 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	46,631,351 - 46,631,501	NCBI	Rnor6.0
Rnor_5.0	6	55,344,451 - 55,344,601	UniSTS	Rnor5.0
RGSC_v3.4	6	45,142,750 - 45,142,900	UniSTS	RGSC3.4
Celera	6	43,254,241 - 43,254,391	UniSTS
Cytogenetic Map	6	q16	UniSTS

UniSTS:547149

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	44,008,873 - 44,008,933 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	46,630,508 - 46,630,567	NCBI	Rnor6.0
Rnor_5.0	6	55,343,608 - 55,343,667	UniSTS	Rnor5.0
Celera	6	43,253,398 - 43,253,457	UniSTS
Cytogenetic Map	6	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		12	4	4		4			54	14	21
Low		15	13	6	17	6	2	2	18	19	12	6	2
Below cutoff	2	12	22	15	2	15	6	9	2	2	8	4	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ004858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000045963 ⟹ ENSRNOP00000040127

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	44,008,340 - 44,010,354 (-)	Ensembl
Rnor_6.0 Ensembl	6	46,629,974 - 46,631,983 (-)	Ensembl

RefSeq Acc Id:

NM_053349 ⟹ NP_445801

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	44,008,333 - 44,010,354 (-)	NCBI
Rnor_6.0	6	46,629,967 - 46,631,988 (-)	NCBI
Rnor_5.0	6	55,343,067 - 55,345,088 (-)	NCBI
RGSC_v3.4	6	45,141,366 - 45,143,387 (-)	RGD
Celera	6	43,252,857 - 43,254,878 (-)	RGD

Sequence:

show sequence

GACTTTTTTGCAGAAGAAGGGCGCGCGCCTGGGAGTGCTTTGGGGTCCCGGCGCTTGCGGCGGC
TGCCAGGAGTTGGAGAGCGAGAAATTAAAGCGATTGAGAGAGAGAGCGCGCGCGGTTCCGGGCC
CGCCGCCGCTTCTTTTCCGGTCGCCGCAGCCGCCGCCGCAGCAGGGAACGGGACCGGGGGGGAG
GGGGGCAGCCGCGGACCCGCGGGGCCAAGGACTTTGCAACTTGCCGGAGAAGGTGGAGGGGCGG
GAGGGGGAGGGGCGCCCGCGCAGGAGACCGAGCGCCCAGCCCCGCCGCGGACCATGGTGCAGCA
GGCCGAGAGCTCGGAAGCCGAGAGCAACCTGCCCCGGGACGCGCTGGACACCGAGGAGGGCGAG
TTCATGGCGTGCAGCCCGGTGGCCCTGGATGAGAGCGACCCGGACTGGTGCAAGACGGCGTCGG
GCCACATCAAACGGCCCATGAACGCCTTCATGGTGTGGTCCAAGATCGAGCGCAGGAAGATCAT
GGAGCAGTCGCCCGACATGCATAACGCCGAGATCTCCAAGAGGCTGGGCAAGCGTTGGAAGATG
CTGAAGGACAGCGAGAAGATCCCGTTCATCCGGGAGGCGGAGCGCCTGCGCCTCAAGCACATGG
CTGATTATCCCGACTACAAGTACCGGCCGCGCAAAAAGCCCAAGACGGACCCAGCCGCCAAGCC
CAGCGCGGGCCAGAGCCCGGACAAGAGCGCGGCGGGCGCTAAGGCAGCCAAGGGCCCGGGCAAG
AAGTGCGCCAAGCTCAAGGCGCCTGCGGGCAAGGCGGGCGCAGGCAAGGCGGCGCAGCCTGGGG
ACTGCGGCGCGGGCAAGGCAGCCAAGTGCGTCTTCCTGGACGACGATGATGAAGAGGACGACGA
GGACGACGAGCTGCAGCTACGGCCCAAGCCGGACGCAGACGACGACGACGACGAGCCCGCGCAC
TCGCACCTGCTGCCGCCACCGGCGCAGCAGCAGCCCCCTCAGCTGCTGAGGCGCTACAGCGTGG
CCAAGGTGCCCGCCAGCCCCACGCTCAGCAGTGCCGCCGAGTCCCCCGAGGGCGCGAGCCTTTA
CGACGAAGTGCGCGCGGGCGGCCGGCTCTACTACAGCTTCAAGAACATCACCAAGCAGCAGCCT
CCGCCCGCGCCTCCCGCGCTGTCGCCCGCGTCCTCGCGCTGCGTGTCCACCTCCTCATCCAGCG
GCAGCAGCAGCGGCAGCGGCGCCGAGGATGCCGACGACCTCATGTTCGACCTGAGCTTGAATTT
CTCCCAGGGCGCGCACAGCGCCTGCGAGCAGCCACTGGGCGCGGGAGCGGCGGGGAACCTGTCC
CTGTCGCTGGTGGATAAGGACCTGGATTCCTTCAGCGAGGGCAGCCTGGGCTCCCACTTCGAGT
TCCCCGACTACTGCACGCCGGAGCTGAGCGAGATGATCGCGGGGGACTGGCTGGAGGCGAACTT
CTCCGACCTGGTGTTCACGTATTGAGGGGCACAGGGCTCCTCGGGAGGCAGTCGTGGCGGTCAG
GATAAAGAGGATGGTGGGGGGAGGGGGAGAAGATGCTCATGGTCAGAGATGTGGCGCAGAGAAA
TTGGAAACGGTGATGAAATGTTGGAGTTAAAGTGAAATGAGTAGTTTTAAACAGATTTTCCAGG
TTTTTTTTTTTAATCTTTTAATTTTTAAAAAAATTTTTTGGTCTCCCCACTCTTCCCTTCCTTT
ATCGTGTCTCAAGGTAGTTGCACACCTAGTCTGGATTGTGATTTCCCCCACCCGTAAAAAAATC
GTGTTTTGTAATTTCTATTTCTTTTTCCTGAAATTCGTGATTGCAACAAAGGCGGAGGGGACCG
GGCGGGGGAGGGGAGGAGGCCCCGCTCCGGAAGGCGCTGTTTGAAGCTCGTGGCTCTTTGAAGT
CTGAAAGACGTCGGCAGAGGACCCTTTAGACGGCACAACTGTTACTCTAGGGAGTTGATATTTT
TTTTTCTTAAGAGATTTAAAAAGGAACTGGTGATTTAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445801	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA06166	(Get FASTA)	NCBI Sequence Viewer
	EDM03208	(Get FASTA)	NCBI Sequence Viewer
	P0C1G9	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_445801 ⟸ NM_053349

- UniProtKB:

Q04889 (UniProtKB/Swiss-Prot), P0C1G9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MVQQAESSEAESNLPRDALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIER
RKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKTDP
AAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAGKAGAGKAAQPGDCGAGKAAKCVFLDDDDE
EDDEDDELQLRPKPDADDDDDEPAHSHLLPPPAQQQPPQLLRRYSVAKVPASPTLSSAAESPEG
ASLYDEVRAGGRLYYSFKNITKQQPPPAPPALSPASSRCVSTSSSSGSSSGSGAEDADDLMFDL
SLNFSQGAHSACEQPLGAGAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWL
EANFSDLVFTY

hide sequence

RefSeq Acc Id:

ENSRNOP00000040127 ⟸ ENSRNOT00000045963

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P0C1G9-F1-model_v2	AlphaFold	P0C1G9	1-395	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694529

Promoter ID:

EPDNEW_R5052

Type:

single initiation site

Name:

Sox11_1

Description:

SRY box 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	46,631,983 - 46,632,043	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69351	AgrOrtholog
BioCyc Gene	G2FUF-37986	BioCyc
Ensembl Genes	ENSRNOG00000030034	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000040127	ENTREZGENE
	ENSRNOP00000040127.3	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000045963	ENTREZGENE
	ENSRNOT00000045963.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.30.10	UniProtKB/Swiss-Prot
InterPro	HMG_box_dom	UniProtKB/Swiss-Prot
	HMG_box_dom_sf	UniProtKB/Swiss-Prot
	SOX-11/4	UniProtKB/Swiss-Prot
KEGG Report	rno:84046	UniProtKB/Swiss-Prot
NCBI Gene	84046	ENTREZGENE
PANTHER	PTHR10270:SF113	UniProtKB/Swiss-Prot
	SOX TRANSCRIPTION FACTOR	UniProtKB/Swiss-Prot
Pfam	HMG_box	UniProtKB/Swiss-Prot
PhenoGen	Sox11	PhenoGen
PIRSF	SOX-12/11/4a	UniProtKB/Swiss-Prot
PROSITE	HMG_BOX_2	UniProtKB/Swiss-Prot
SMART	HMG	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47095	UniProtKB/Swiss-Prot
TIGR	TC221702
UniProt	P0C1G9	ENTREZGENE
	Q04889	ENTREZGENE
	SOX11_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	O35178	UniProtKB/Swiss-Prot
	O89036	UniProtKB/Swiss-Prot
	Q04889	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-05	Sox11	SRY-box transcription factor 11	Sox11	SRY box 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-13	Sox11	SRY box 11	Sox11	SRY (sex determining region Y)-box 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Sox11	SRY (sex determining region Y)-box 11	Sox11	SRY-box containing gene 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Sox11	SRY-box containing gene 11			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM