Serpinh1 (serpin family H member 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Serpinh1 (serpin family H member 1) Rattus norvegicus

Analyze

Symbol:

Serpinh1

Name:

serpin family H member 1

RGD ID:

69302

Description:

Predicted to enable serine-type endopeptidase inhibitor activity and unfolded protein binding activity. Involved in response to vitamin D. Predicted to be located in endoplasmic reticulum-Golgi intermediate compartment and membrane raft. Predicted to be active in endoplasmic reticulum. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 10 and preterm premature rupture of the membranes. Orthologous to human SERPINH1 (serpin family H member 1); INTERACTS WITH (R)-lipoic acid; (R)-noradrenaline; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

47 kDa heat shock protein; Cbp2; collagen binding protein 2; collagen-binding protein; colligin; GP46; serine (or cysteine) peptidase inhibitor, clade H, member 1; serine (or cysteine) proteinase inhibitor clade H (heat shock protein 47) member 1; serine (or cysteine) proteinase inhibitor clade H (heat shock protein 47) member 2; serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1; serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2; serine (or cysteine) proteinase inhibitor, clade H, member 1; serine proteinase inhibitor clade H (heat shock protein 47) member 1; serine proteinase inhibitor, clade H (heat shock protein 47), member 1; serpin H1; serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1); serpin peptidase inhibitor, clade H, member 1; Serpinh2

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	153,643,500 - 153,650,853 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	153,643,510 - 153,650,801 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	161,639,548 - 161,646,892 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	168,819,703 - 168,827,047 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	161,693,225 - 161,700,569 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	164,301,010 - 164,308,306 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	164,301,010 - 164,308,317 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	170,503,468 - 170,510,764 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	156,666,914 - 156,674,210 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	156,745,319 - 156,752,617 (-)	NCBI
Celera	1	151,727,297 - 151,734,593 (-)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult respiratory distress syndrome (ISO)

Experimental Liver Cirrhosis (ISO)

intellectual disability (ISO)

ischemia (ISO)

liver cirrhosis (ISO)

middle cerebral artery infarction (ISO)

osteogenesis imperfecta (ISO)

osteogenesis imperfecta type 10 (ISO)

Peritoneal Fibrosis (IEP,IMP,ISO)

preterm premature rupture of the membranes (ISO)

Schistosomiasis Japonica (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-lipoic acid (EXP)

(R)-noradrenaline (EXP)

(S)-amphetamine (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-butoxyethanol (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

alachlor (EXP)

aldehydo-D-glucosamine (ISO)

alendronic acid (EXP)

all-trans-retinoic acid (EXP,ISO)

aluminium oxide (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benazepril (EXP)

benzo[a]pyrene (ISO)

beta-D-glucosamine (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

cadmium atom (EXP,ISO)

cadmium sulfate (ISO)

calciol (ISO)

carbon nanotube (ISO)

carvedilol (EXP)

celecoxib (EXP)

chloropicrin (ISO)

chloroprene (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

curcumin (EXP)

cyanocob(III)alamin (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

Diallyl sulfide (EXP)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

diclofenac (ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (EXP,ISO)

fenamidone (ISO)

flavonoids (EXP)

flutamide (EXP)

furan (EXP)

gentamycin (EXP)

gold atom (ISO)

gold(0) (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP)

ivermectin (ISO)

ketoconazole (ISO)

levofloxacin (EXP)

lipoic acid (EXP)

lipopolysaccharide (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

N,N-diethyl-m-toluamide (EXP)

N-acetyl-L-cysteine (ISO)

N-nitrosodimethylamine (EXP,ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nicotine (ISO)

oxaliplatin (EXP,ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

pentane-2,3-dione (EXP)

permethrin (EXP)

PhIP (EXP)

pirinixic acid (EXP)

potassium dichromate (ISO)

raloxifene (EXP)

reactive oxygen species (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 203580 (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium fluoride (EXP)

Soman (EXP)

sorafenib (EXP)

streptozocin (EXP)

sunitinib (EXP)

tamoxifen (EXP,ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

Tributyltin oxide (ISO)

trichostatin A (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

wortmannin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chondrocyte development involved in endochondral bone morphogenesis (IEA,ISO)

collagen biosynthetic process (IEA,ISO)

collagen fibril organization (IBA,IEA,ISO)

negative regulation of endopeptidase activity (IBA)

protein maturation (IEA,ISO)

response to organic cyclic compound (IEP)

response to vitamin D (IEP)

Cellular Component

cytoplasm (ISO)

endoplasmic reticulum (IBA,IEA,ISO)

endoplasmic reticulum lumen (IEA)

endoplasmic reticulum-Golgi intermediate compartment (IEA,ISO)

extracellular space (IEA)

membrane raft (IEA,ISO)

Molecular Function

collagen binding (IEA,TAS)

protein binding (ISO)

serine-type endopeptidase inhibitor activity (IBA,IEA)

unfolded protein binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A collagen-binding protein in the endoplasmic reticulum of myoblasts exhibits relationship with serine protease inhibitors.	Clarke EP, etal., J Biol Chem 1991 Sep 15;266(26):17230-5.
2.	Therapeutic effect of 1,25(OH)2-VitaminD3 on fibrosis and angiogenesis of peritoneum induced by chlorhexidine.	Da J, etal., Biomed Pharmacother. 2020 Sep;129:110431. doi: 10.1016/j.biopha.2020.110431. Epub 2020 Jun 22.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Involvement of heat shock protein 47 in Schistosoma japonicum-induced hepatic fibrosis in mice.	Huang JQ, etal., Int J Parasitol. 2014 Jan;44(1):23-35. doi: 10.1016/j.ijpara.2013.08.009. Epub 2013 Dec 1.
6.	Xiaochaihu decorction relieves liver fibrosis caused by Schistosoma japonicum infection via the HSP47/TGF-β pathway.	Huang Y, etal., Parasit Vectors. 2020 May 14;13(1):254. doi: 10.1186/s13071-020-04121-2.
7.	Expression of heat shock protein 47, transforming growth factor-beta 1, and connective tissue growth factor in liver tissue of patients with Schistosoma japonicum-induced hepatic fibrosis.	Li L, etal., Parasitology. 2015 Feb;142(2):341-51. doi: 10.1017/S0031182014001115. Epub 2014 Aug 11.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Enhanced expression of heat shock protein 47 in rat model of peritoneal fibrosis.	Mishima Y, etal., Perit Dial Int. 2003 Jan-Feb;23(1):14-22.
10.	The human genome has only one functional hsp47 gene (CBP2) and a pseudogene (pshsp47).	Nagai N, etal., Gene 1999 Feb 18;227(2):241-8.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Antisense oligonucleotides against collagen-binding stress protein HSP47 suppress peritoneal fibrosis in rats.	Nishino T, etal., Kidney Int. 2003 Sep;64(3):887-96. doi: 10.1046/j.1523-1755.2003.00169.x.
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
18.	Identification of hypertension-related genes through an integrated genomic-transcriptomic approach.	Yagil C, etal., Circ Res. 2005 Apr 1;96(6):617-25. Epub 2005 Feb 24.
19.	[Roles of transforming growth factor - β1 and heat shock protein 47 in progression of Schistosoma japonicum-induced hepatic fibrosis].	Yong-Hua Z, etal., Zhongguo Xue Xi Chong Bing Fang Zhi Za Zhi. 2019 Sep 25;31(4):382-387. doi: 10.16250/j.32.1374.2018208.
20.	TNP-470, an angiogenesis inhibitor, suppresses the progression of peritoneal fibrosis in mouse experimental model.	Yoshio Y, etal., Kidney Int. 2004 Oct;66(4):1677-85. doi: 10.1111/j.1523-1755.2004.00935.x.

Additional References at PubMed

PMID:2158279	PMID:8018053	PMID:10862616	PMID:10995453	PMID:12477932	PMID:15033773	PMID:15308636	PMID:17054723	PMID:21412710	PMID:21606205	PMID:22082260	PMID:22492985
PMID:22658674	PMID:22718885	PMID:23376485	PMID:24650661	PMID:25204797	PMID:25526199	PMID:30092114	PMID:30361391	PMID:31686426

Genomics

Comparative Map Data

Serpinh1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	153,643,500 - 153,650,853 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	153,643,510 - 153,650,801 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	161,639,548 - 161,646,892 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	168,819,703 - 168,827,047 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	161,693,225 - 161,700,569 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	164,301,010 - 164,308,306 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	164,301,010 - 164,308,317 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	170,503,468 - 170,510,764 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	156,666,914 - 156,674,210 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	156,745,319 - 156,752,617 (-)	NCBI
Celera	1	151,727,297 - 151,734,593 (-)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

SERPINH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	75,562,253 - 75,572,783 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	75,562,056 - 75,572,783 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	75,273,298 - 75,283,828 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	74,950,818 - 74,961,494 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	74,950,817 - 74,961,492	NCBI
Celera	11	72,580,950 - 72,591,621 (+)	NCBI		Celera
Cytogenetic Map	11	q13.5	NCBI
HuRef	11	71,570,181 - 71,580,924 (+)	NCBI		HuRef
CHM1_1	11	75,156,705 - 75,167,451 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	75,491,635 - 75,502,159 (+)	NCBI		T2T-CHM13v2.0

Serpinh1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	98,994,582 - 99,002,480 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	98,994,583 - 99,002,446 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	99,345,375 - 99,353,239 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	99,345,376 - 99,353,239 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	106,493,885 - 106,501,749 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	99,219,459 - 99,227,179 (-)	NCBI		MGSCv36	mm8
Celera	7	99,670,192 - 99,678,104 (-)	NCBI		Celera
Cytogenetic Map	7	E1	NCBI

Serpinh1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	16,284,845 - 16,292,963 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	16,284,845 - 16,292,828 (-)	NCBI	ChiLan1.0	ChiLan1.0

SERPINH1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	11	73,922,617 - 73,933,379 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	11	70,621,893 - 70,632,570 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SERPINH1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	23,032,761 - 23,041,649 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	23,032,767 - 23,041,625 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	22,798,470 - 22,807,285 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	23,235,602 - 23,244,497 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	23,235,605 - 23,244,400 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	23,034,077 - 23,042,936 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	23,230,397 - 23,239,216 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	23,148,229 - 23,157,093 (-)	NCBI		UU_Cfam_GSD_1.0

Serpinh1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	62,742,342 - 62,751,791 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936498	4,341,899 - 4,351,524 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936498	4,341,944 - 4,351,432 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SERPINH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	9,783,042 - 9,794,483 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	9,782,939 - 9,794,485 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	10,966,800 - 10,977,248 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SERPINH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	66,787,978 - 66,798,930 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	66,788,240 - 66,799,072 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	59,006,758 - 59,017,494 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Serpinh1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624817	1,561,471 - 1,570,947 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624817	1,561,471 - 1,570,425 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Serpinh1
24 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	132
Count of miRNA genes:	97
Interacting mature miRNAs:	114
Transcripts:	ENSRNOT00000022983
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642722	214537671	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	136745990	163747690	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383635	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	144267916	172949660	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144267916	174133260	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat

Markers in Region

RH128077

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	153,643,656 - 153,643,874 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	164,301,159 - 164,301,376	NCBI	Rnor6.0
Rnor_5.0	1	170,503,617 - 170,503,834	UniSTS	Rnor5.0
RGSC_v3.4	1	156,667,063 - 156,667,280	UniSTS	RGSC3.4
Celera	1	151,727,446 - 151,727,663	UniSTS
RH 3.4 Map	1	1244.7	UniSTS
Cytogenetic Map	1	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		4								12	13
Medium	3	39	54	38	19	38	8	11	74	23	26	11	8
Low			3	3		3					2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222513	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M69246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000022983 ⟹ ENSRNOP00000022983

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	164,301,010 - 164,308,317 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086091 ⟹ ENSRNOP00000070279

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	153,643,510 - 153,650,801 (-)	Ensembl
Rnor_6.0 Ensembl	1	164,301,614 - 164,307,084 (-)	Ensembl

RefSeq Acc Id:

NM_017173 ⟹ NP_058869

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	153,643,500 - 153,650,846 (-)	NCBI
Rnor_6.0	1	164,301,010 - 164,308,306 (-)	NCBI
Rnor_5.0	1	170,503,468 - 170,510,764 (-)	NCBI
RGSC_v3.4	1	156,666,914 - 156,674,210 (-)	RGD
Celera	1	151,727,297 - 151,734,593 (-)	RGD

Sequence:

show sequence

AGCGGACGCTGTCTGAGGAGTAGAGCCTGCCTGAGAGCGAGTGTCCCGTCGGTCCCGGAGCAGC
CCAGCCCGGCCCAGCCCTCACAGGTCCTCTGTGGTGCACACAGCCCACCTCCCAGCCATGCGCT
CTCTCCTTCTGGGCACCTTATGCCTCCTGGCTGTGGCCCTGGCAGCCGAGGTGAAGAAACCTGT
AGAGGCCGCAGCCCCTGGTACTGCGGAGAAGCTGAGTTCCAAGGCGACCACACTGGCAGAGCGC
AGCACAGGCCTGGCCTTCAGCCTGTATCAGGCAATGGCCAAAGATCAGGCGGTGGAGAATATCC
TCCTGTCACCCTTGGTGGTGGCCTCATCCCTGGGCCTTGTGTCACTGGGTGGTAAAGCCACCAC
AGCTTCGCAGGCGAAGGCAGTGTTGAGCGCTGAGAAGCTGCGGGATGAGGAGGTGCACACGGGG
CTGGGCGAGCTCGTGCGCTCCCTCAGTAACTCCACTGCGCGCAATGTGACCTGGAAACTGGGCA
GCCGCCTGTACGGGCCCAGCTCCGTGAGCTTCGCCGATGACTTCGTGCGCAGCAGTAAGCAACA
CTACAACTGTGAACACTCCAAGATCAACTTCCGAGACAAGCGCAGCGCGCTGCAGTCCATCAAC
GAGTGGGCCTCGCAGACCACCGACGGCAAGCTGCCAGAGGTCACCAAGGATGTGGAGCGCACGG
ATGGGGCACTGCTCGTTAATGCCATGTTCTTTAAGCCGCACTGGGATGAGAAGTTCCACCATAA
GATGGTAGACAACCGTGGCTTCATGGTGACCCGCTCCTACACTGTGGGTGTTACGATGATGCAC
CGGACAGGCCTCTACAACTACTATGACGACGAGAAGGAGAAGCTGCAGCTGGTGGAGATGCCCT
TGGCCCATAAGCTCTCCAGCCTCATCATCCTCATGCCCCACCACGTAGAACCGCTCGAGCGCCT
GGAGAAGTTGCTGACCAAGGAGCAACTAAAGACCTGGATGGGGAAGATGCAGAAGAAGGCTGTT
GCCATCTCCCTGCCCAAGGGAGTGGTGGAGGTGACCCATGACCTGCAGAAACATCTGGCCGGAC
TGGGCCTGACTGAGGCCATCGACAAGAACAAGGCAGACTTATCGCGCATGTCTGGCAAGAAGGA
TCTGTACCTGGCCAGTGTGTTCCACGCCACTGCCTTCGAGTGGGACACAGAGGGCAACCCCTTT
GACCAGGACATCTACGGGCGTGAGGAGCTGCGCAGCCCCAAGCTGTTCTATGCCGACCACCCCT
TCATCTTCCTGGTGCGAGATAATCAGAGCGGCTCCTTGCTGTTCATTGGCCGCCTGGTCCGGCC
CAAGGGAGACAAGATGCGAGACGAGTTGTAGAGTCCAAGAGTGGTCGTGGCGTGGCATGGCGGG
AAGTAGCCAGAGGTTCCTGAGACACATGGGTGCTATTGTGGGGGGAGGGGGAGGCACCAACCCT
GGATAGTCCACGGGTGGGGGGGGGTTGGCAGTGCAGATCGGAATTCCCATAGGTCTGAGTAGGT
ATTTTTAGACAAGAGTCCACTCCGTTAGACATGGAGCCCAGACACTATGAGACCAAATTCAGGG
GTGTCACAGCCATTCTAGCCCTGCCCCACAAGTTTTATATCCAATCTAGCCTCAACAGTCAATC
AGTGTTCATATTCGTGGCCAAGCATTCTGTCTGTGAGACAATCGAGTTGGGTGGGGGTAGGGCG
GCCTAGCCTCTCTGTCACCATGCCCTGAGCCCTCGGTTTTCCTGTTCACCTCTGATTCCCTTTA
ACCACAAAACTAGGAGCCTGTGGTCCCAGAACTGCCCACCCTTAAAATCGATTCTTTGCCGCAG
CAGTGGGAGTTGGGGAGACCATGCATAGGAGGGCTCCTTGGCATATCCGGCCCTAGAGCCATTA
CATTACATTGACAACTCAACTTTGCTTCTGTTTTCTCCCTTTTTGAGTTTTTCAAGGAATGGGG
GTTTGGGGAAGGGGAAGCCTTTATTGCTTTCAAAACAAGAACAGTTTGTCAATTTTTTTTGAAT
AAACCTTTTCCAATG

hide sequence

RefSeq Acc Id:

XM_039107102 ⟹ XP_038963030

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	153,643,500 - 153,650,853 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058869	(Get FASTA)	NCBI Sequence Viewer
	XP_038963030	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41270	(Get FASTA)	NCBI Sequence Viewer
	AAH86529	(Get FASTA)	NCBI Sequence Viewer
	EDM18410	(Get FASTA)	NCBI Sequence Viewer
	EDM18411	(Get FASTA)	NCBI Sequence Viewer
	EDM18412	(Get FASTA)	NCBI Sequence Viewer
	EDM18413	(Get FASTA)	NCBI Sequence Viewer
	P29457	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_058869 ⟸ NM_017173
- Peptide Label:	precursor
- UniProtKB:	Q5RJR9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRSLLLGTLCLLAVALAAEVKKPVEAAAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVE NILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELVRSLSNSTARNVTWK LGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWASQTTDGKLPEVTKDVE RTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKLQLVE MPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKTWMGKMQKKAVAISLPKGVVEVTHDLQKHL AGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTEGNPFDQDIYGREELRSPKLFYAD HPFIFLVRDNQSGSLLFIGRLVRPKGDKMRDEL hide sequence

RefSeq Acc Id:

ENSRNOP00000022983 ⟸ ENSRNOT00000022983

RefSeq Acc Id:

ENSRNOP00000070279 ⟸ ENSRNOT00000086091

RefSeq Acc Id:	XP_038963030 ⟸ XM_039107102
- Peptide Label:	isoform X1
- UniProtKB:	Q5RJR9 (UniProtKB/TrEMBL)

Protein Domains

SERPIN

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P29457-F1-model_v2	AlphaFold	P29457	1-417	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690228

Promoter ID:

EPDNEW_R751

Type:

multiple initiation site

Name:

Serpinh1_1

Description:

serpin family H member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	164,308,307 - 164,308,367	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69302	AgrOrtholog
BioCyc Gene	G2FUF-58392	BioCyc
Ensembl Genes	ENSRNOG00000016831	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000070279	ENTREZGENE
	ENSRNOP00000070279.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000086091	ENTREZGENE
	ENSRNOT00000086091.2	UniProtKB/TrEMBL
Gene3D-CATH	2.30.39.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.30.497.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7303866	IMAGE-MGC_LOAD
InterPro	Serpin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Serpin_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Serpin_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Serpin_H1_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Serpin_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Serpin_sf_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Serpin_sf_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SERPINH1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29345	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105471	IMAGE-MGC_LOAD
NCBI Gene	29345	ENTREZGENE
PANTHER	PTHR11461	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11461:SF27	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Serpin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Serpinh1	PhenoGen
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
	SERPIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SERPIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56574	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228672
UniProt	P29457	ENTREZGENE
	Q5RJR9	ENTREZGENE, UniProtKB/TrEMBL
	SERPH_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Serpinh1	serpin family H member 1	Serpinh1	serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-16	Serpinh1	serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)	Serpinh1	serpin peptidase inhibitor, clade H, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-03-05	Serpinh1	serpin peptidase inhibitor, clade H, member 1	Serpinh1	serine (or cysteine) peptidase inhibitor, clade H, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Serpinh1	serine (or cysteine) peptidase inhibitor, clade H, member 1	Serpinh1	serine (or cysteine) proteinase inhibitor, clade H, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Serpinh1	serine (or cysteine) proteinase inhibitor, clade H, member 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	identified as a possible hypertension gene	1559295

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM