Chrna1 (cholinergic receptor nicotinic alpha 1 subunit)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Chrna1 (cholinergic receptor nicotinic alpha 1 subunit) Rattus norvegicus

Analyze

Symbol:

Chrna1

Name:

cholinergic receptor nicotinic alpha 1 subunit

RGD ID:

69277

Description:

Enables acetylcholine-gated cation-selective channel activity. Involved in cation transport and skeletal muscle contraction. Part of acetylcholine-gated channel complex. Human ortholog(s) of this gene implicated in congenital myasthenic syndrome 1A and congenital myasthenic syndrome 1B. Orthologous to human CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; INTERACTS WITH acetylcholine; acrylamide; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acetylcholine receptor subunit alpha; cholinergic receptor nicotinic alpha polypeptide 1; cholinergic receptor nicotinic alpha polypeptide 1 (muscle); cholinergic receptor, nicotinic, alpha 1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1; cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Chrna1 (cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chrna1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chrna1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chrna1 (cholinergic receptor nicotinic alpha 1 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CHRNA1 (cholinergic receptor nicotinic alpha 1 subunit)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chrna1 (cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chrna1 (cholinergic receptor, nicotinic, alpha 1 (muscle))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	acr-12	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-6	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	nAChRalpha1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	nAChRbeta2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	nAChRalpha3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	nAChRalpha4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	unc-38	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lev-8	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	acr-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	58,454,763 - 58,469,832 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	58,454,744 - 58,469,840 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,848,304 - 61,863,363 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	70,431,954 - 70,447,013 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	68,196,984 - 68,212,044 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	60,445,657 - 60,460,724 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	60,445,666 - 60,460,724 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,925,891 - 66,940,958 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	56,087,754 - 56,102,821 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,984,129 - 55,999,193 (-)	NCBI
Celera	3	57,981,902 - 57,996,970 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

congenital myasthenic syndrome (ISO)

congenital myasthenic syndrome 1A (ISO)

congenital myasthenic syndrome 1B (ISO)

congenital myasthenic syndrome 2A (ISO)

Congenital Myasthenic Syndrome, Fast-Channel (ISO)

epilepsy (ISO)

Experimental Autoimmune Myasthenia Gravis (ISO)

Fibrosis (ISO)

genetic disease (ISO)

Hydrops Fetalis (ISO)

juvenile myoclonic epilepsy (ISO)

multiple pterygium syndrome (ISO)

Multiple Pterygium Syndrome, Lethal Type (ISO)

Pleural Effusion (ISO)

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

acetylcholine (EXP,ISO)

acrylamide (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bromobenzene (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

clofibrate (ISO)

Cuprizon (EXP)

dichlorine (EXP)

dieldrin (EXP)

dioxygen (ISO)

disulfoton (EXP)

epibatidine (EXP)

flavonoids (EXP)

genistein (EXP)

heptachlor (EXP)

hydralazine (ISO)

imidacloprid (EXP)

lipopolysaccharide (ISO)

methoxychlor (EXP)

mirex (EXP)

nicotine (ISO)

ozone (EXP)

paracetamol (ISO)

pioglitazone (ISO)

spermine (ISO)

sulfoxaflor (EXP)

testosterone (ISO)

trichloroethene (EXP)

tubocurarine (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetylcholine receptor signaling pathway (ISO,NAS)

chemical synaptic transmission (IBA)

excitatory postsynaptic potential (IEA)

monoatomic cation transport (IDA)

monoatomic ion transmembrane transport (IBA)

muscle cell cellular homeostasis (ISO)

musculoskeletal movement (ISO)

nervous system process (IBA)

neuromuscular junction development (ISO)

neuromuscular process (ISO)

neuromuscular synaptic transmission (ISO)

neuron cellular homeostasis (ISO)

neuronal action potential (ISO)

regulation of membrane potential (IBA,ISO)

signal transduction (IBA)

skeletal muscle contraction (IDA,ISO)

skeletal muscle tissue growth (ISO)

synaptic transmission, cholinergic (IEA)

Cellular Component

acetylcholine-gated channel complex (IDA,ISO,NAS,TAS)

cell surface (ISO)

membrane (ISO)

neuromuscular junction (ISO)

neuron projection (IBA)

obsolete integral component of postsynaptic specialization membrane (ISO)

plasma membrane (IBA,ISO)

postsynaptic specialization membrane (ISO)

synapse (IBA,IEA)

Molecular Function

acetylcholine binding (ISO)

acetylcholine receptor activity (ISO)

acetylcholine-gated monoatomic cation-selective channel activity (IBA,IDA,ISO)

excitatory extracellular ligand-gated monoatomic ion channel activity (IBA)

neurotransmitter receptor activity (IBA)

protein binding (ISO)

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acetylcholine signaling pathway via nicotinic acetylcholine receptor (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Multiple inhibitory actions of lidocaine on Torpedo nicotinic acetylcholine receptors transplanted to Xenopus oocytes.	Alberola-Die A, etal., J Neurochem. 2011 Jun;117(6):1009-19. doi: 10.1111/j.1471-4159.2011.07271.x. Epub 2011 May 10.
2.	Mammalian nicotinic acetylcholine receptors: from structure to function.	Albuquerque EX, etal., Physiol Rev. 2009 Jan;89(1):73-120. doi: 10.1152/physrev.00015.2008.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Suppression of ongoing experimental myasthenia by oral treatment with an acetylcholine receptor recombinant fragment.	Im SH, etal., J Clin Invest 1999 Dec;104(12):1723-30.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	A novel mode-of-action mediated by the fetal muscle nicotinic acetylcholine receptor resulting in developmental toxicity in rats.	Rasoulpour RJ, etal., Toxicol Sci. 2012 Jun;127(2):522-34. doi: 10.1093/toxsci/kfs118. Epub 2012 Mar 29.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Refined structure of the nicotinic acetylcholine receptor at 4A resolution.	Unwin N, J Mol Biol. 2005 Mar 4;346(4):967-89. doi: 10.1016/j.jmb.2004.12.031. Epub 2005 Jan 25.
14.	Primary structure and functional expression of the alpha-, beta-, gamma-, delta- and epsilon-subunits of the acetylcholine receptor from rat muscle.	Witzemann V, etal., Eur J Biochem 1990 Dec 12;194(2):437-48.
15.	The neuromuscular junction: selective remodeling of synaptic regulators at the nerve/muscle interface.	Witzemann V, etal., Mech Dev. 2013 Jun-Aug;130(6-8):402-11. doi: 10.1016/j.mod.2012.09.004. Epub 2012 Sep 29.

Additional References at PubMed

PMID:2383398	PMID:4781450	PMID:8872460	PMID:8910344	PMID:9221765	PMID:9546329	PMID:12388596	PMID:12928480	PMID:16203963	PMID:18252226	PMID:20053883	PMID:21187406

Genomics

Comparative Map Data

Chrna1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	58,454,763 - 58,469,832 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	58,454,744 - 58,469,840 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,848,304 - 61,863,363 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	70,431,954 - 70,447,013 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	68,196,984 - 68,212,044 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	60,445,657 - 60,460,724 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	60,445,666 - 60,460,724 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,925,891 - 66,940,958 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	56,087,754 - 56,102,821 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,984,129 - 55,999,193 (-)	NCBI
Celera	3	57,981,902 - 57,996,970 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

CHRNA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	174,747,592 - 174,764,472 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	174,747,592 - 174,787,935 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	175,612,320 - 175,629,200 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	175,320,566 - 175,337,427 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	175,438,113 - 175,454,677	NCBI
Celera	2	169,225,856 - 169,242,726 (-)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	167,492,831 - 167,509,717 (-)	NCBI		HuRef
CHM1_1	2	175,618,423 - 175,635,290 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	175,236,308 - 175,253,177 (-)	NCBI		T2T-CHM13v2.0

Chrna1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	73,393,625 - 73,410,682 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	73,393,559 - 73,410,682 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	73,563,281 - 73,580,338 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	73,563,215 - 73,580,338 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	73,401,338 - 73,418,363 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	73,364,120 - 73,381,145 (-)	NCBI		MGSCv36	mm8
Celera	2	75,249,906 - 75,266,913 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	43.76	NCBI

Chrna1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	661,304 - 683,873 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955449	661,310 - 683,873 (+)	NCBI	ChiLan1.0	ChiLan1.0

CHRNA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2B	179,476,147 - 179,509,974 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	179,476,677 - 179,504,763 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2B	62,022,498 - 62,039,370 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

CHRNA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	18,726,243 - 18,742,505 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	18,726,243 - 18,742,505 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	18,734,972 - 18,751,239 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	18,862,735 - 18,878,999 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	18,860,880 - 18,878,999 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	18,939,222 - 18,955,468 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	18,937,561 - 18,953,818 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	19,048,764 - 19,065,033 (-)	NCBI		UU_Cfam_GSD_1.0

Chrna1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	135,898,803 - 135,941,651 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	4,452,616 - 4,470,658 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936509	4,452,382 - 4,470,658 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHRNA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	80,673,067 - 80,692,208 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	80,673,072 - 80,692,256 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	89,888,938 - 89,906,230 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHRNA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	60,279,837 - 60,298,931 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	139,305,978 - 139,322,913 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chrna1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	11,934,433 - 11,950,005 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	11,933,927 - 11,950,017 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Chrna1
80 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	43
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000024706
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	3	53781112	91609953	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat

Markers in Region

CHRNA1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	58,459,838 - 58,460,577 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	60,450,733 - 60,451,471	NCBI	Rnor6.0
Rnor_5.0	3	66,930,967 - 66,931,705	UniSTS	Rnor5.0
RGSC_v3.4	3	56,092,830 - 56,093,568	UniSTS	RGSC3.4
Celera	3	57,986,977 - 57,987,715	UniSTS
Cytogenetic Map	3	q23	UniSTS

Chrna1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	58,459,835 - 58,460,565 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	60,450,730 - 60,451,459	NCBI	Rnor6.0
Rnor_5.0	3	66,930,964 - 66,931,693	UniSTS	Rnor5.0
Celera	3	57,986,974 - 57,987,703	UniSTS
Cytogenetic Map	3	q23	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium							1	1					1
Low	3	19	42	26	19	26	7	10	66	21	40	11	7
Below cutoff		24	15	15		15			8	14	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000024706 ⟹ ENSRNOP00000024706

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	58,454,744 - 58,469,840 (-)	Ensembl
Rnor_6.0 Ensembl	3	60,445,666 - 60,460,724 (-)	Ensembl

RefSeq Acc Id:

NM_024485 ⟹ NP_077811

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	58,454,763 - 58,469,832 (-)	NCBI
Rnor_6.0	3	60,445,657 - 60,460,724 (-)	NCBI
Rnor_5.0	3	66,925,891 - 66,940,958 (-)	NCBI
RGSC_v3.4	3	56,087,754 - 56,102,821 (-)	RGD
Celera	3	57,981,902 - 57,996,970 (-)	RGD

Sequence:

show sequence

TGCAGCCAGAGTGCCAGGGAGTGGGACAGGCTGCTGGAGGCCACACCAGCGTCCACAGCCCATG
GAGCTCACCGCTGTCCTCCTGCTGCTGGGCCTCTGCTCCGCTGGCACTGTTCTGGGCTCCGAAC
ATGAGACTCGTCTGGTGGCAAAGCTCTTTAAAGACTACAGCAGTGTGGTCCGGCCAGTAGGGGA
CCACCGTGAGATTGTACAGGTCACTGTGGGACTGCAACTGATCCAGCTTATCAACGTGGATGAA
GTAAATCAGATTGTGACAACCAACGTTCGTCTGAAACAGCAATGGGTTGATTACAACTTGAAAT
GGAATCCAGATGACTATGGAGGAGTGAAAAAAATTCACATCCCCTCGGAAAAGATCTGGCGGCC
GGACGTTGTTCTCTATAACAATGCAGATGGAGACTTTGCCATTGTCAAATTCACCAAGGTGCTC
CTGGACTACACCGGTCACATCACCTGGACCCCTCCAGCCATCTTTAAAAGCTACTGTGAGATCA
TTGTCACCCACTTTCCCTTCGATGAGCAGAACTGCAGCATGAAGCTGGGCACTTGGACCTATGA
CGGCTCTGTGGTGGCCATCAATCCGGAAAGTGACCAGCCCGACCTGAGTAACTTCATGGAGAGC
GGAGAGTGGGTGATCAAGGAAGCCCGGGGCTGGAAGCACTGGGTGTTTTACTCCTGCTGCCCCA
ACACCCCTTATCTGGACATCACCTACCACTTCGTCATGCAGCGTCTGCCTCTCTACTTCATTGT
CAACGTCATCATTCCCTGCCTGCTCTTCTCCTTCTTAACCAGTCTGGTGTTCTACCTGCCCACA
GACTCAGGGGAGAAGATGACGCTGAGCATCTCTGTCTTACTGTCCCTGACTGTGTTCCTTCTCG
TCATTGTGGAGCTGATCCCTTCCACCTCTAGCGCTGTACCCCTGATCGGGAAGTACATGTTGTT
TACCATGGTCTTTGTCATTGCGTCCATAATAATCACCGTCATTGTCATCAACACACACCACCGT
TCGCCCAGCACCCACATCATGCCCGAGTGGGTGCGGAAGGTTTTTATCGACACTATCCCAAACA
TCATGTTTTTCTCCACAATGAAAAGACCATCCAGAGATAAACAAGAAAAAAGGATTTTCACAGA
AGACATAGATATCTCTGACATCTCTGGGAAGCCGGGGCCTCCACCTATGGGCTTTCATTCTCCA
CTGATCAAGCACCCTGAGGTGAAAAGCGCCATTGAGGGTGTGAAGTACATTGCAGAGACCATGA
AGTCAGACCAGGAGTCTAACAATGCGTCTGAGGAGTGGAAGTATGTCGCCATGGTGATGGACCA
CATCCTCCTCGGAGTCTTTATGCTGGTGTGTCTCATCGGGACGCTGGCTGTGTTTGCAGGTCGG
CTCATTGAGCTACATCAACAAGGATGAGCAGAAGCTGAACTAAGCCTCCCTCTGCCCCAGCTGC
AGCCACCACCAGGAAAGATAGAAGAGAGGAAGGCCTGTCTACTTGAATCCTTTCGCGCTTACCA
AGCACACAGTGTGCTACATGTCCTGTTAATGATAGTGGTCTCTGCTCACACTGCTATGTCCTTA
AAGTATCTCCCCTTTGCTTCTGCTTTTAACACCATGGGTCTCCTTAAAGAGGGAACCCTTTGTA
GTAAATAAAAGTGAGTCCTCGGGCTGGAGAGATGGCTCAGCGGTTAAGAGCACCCGACTGCTCT
TCCAGAGGTCATGAGTTCAATTCCCAGCAACACATGGTGGCTCACAACCATCTATAAAGAGATC
TGATGCCCTCTTCTGGTGTATCTGAAGACAGCTACAGTGTACTTATATATAATAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077811	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA52826	(Get FASTA)	NCBI Sequence Viewer
	EDL79151	(Get FASTA)	NCBI Sequence Viewer
	EDL79152	(Get FASTA)	NCBI Sequence Viewer
	P25108	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_077811 ⟸ NM_024485
- Peptide Label:	precursor
- UniProtKB:	P25108 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MELTAVLLLLGLCSAGTVLGSEHETRLVAKLFKDYSSVVRPVGDHREIVQVTVGLQLIQLINVD EVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKV LLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFME SGEWVIKEARGWKHWVFYSCCPNTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTSLVFYLP TDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHH RSPSTHIMPEWVRKVFIDTIPNIMFFSTMKRPSRDKQEKRIFTEDIDISDISGKPGPPPMGFHS PLIKHPEVKSAIEGVKYIAETMKSDQESNNASEEWKYVAMVMDHILLGVFMLVCLIGTLAVFAG RLIELHQQG hide sequence

RefSeq Acc Id:

ENSRNOP00000024706 ⟸ ENSRNOT00000024706

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P25108-F1-model_v2	AlphaFold	P25108	1-457	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69277	AgrOrtholog
BioCyc Gene	G2FUF-49365	BioCyc
Ensembl Genes	ENSRNOG00000018286	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000024706	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024706	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
	Neurotransmitter_ion_chnl_CS	UniProtKB/Swiss-Prot
	Nicotinic_acetylcholine_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:79557	UniProtKB/Swiss-Prot
NCBI Gene	79557	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PhenoGen	Chrna1	PhenoGen
PRINTS	NICOTINICR	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
PROSITE	NEUROTR_ION_CHANNEL	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
TIGRFAMs	LIC	UniProtKB/Swiss-Prot
UniProt	ACHA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Chrna1	cholinergic receptor nicotinic alpha 1 subunit	Chrna1	cholinergic receptor, nicotinic, alpha 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-12	Chrna1	cholinergic receptor, nicotinic, alpha 1	Chrna1	cholinergic receptor, nicotinic, alpha 1 (muscle)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Chrna1	cholinergic receptor, nicotinic, alpha 1 (muscle)	Chrna1	cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Chrna1	cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)		cholinergic receptor, nicotinic, alpha polypeptide 1	Name updated	1299863	APPROVED
2002-06-10	Chrna1	cholinergic receptor, nicotinic, alpha polypeptide 1			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations