Tmed2 (transmembrane p24 trafficking protein 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tmed2 (transmembrane p24 trafficking protein 2) Rattus norvegicus

Analyze

Symbol:

Tmed2

Name:

transmembrane p24 trafficking protein 2

RGD ID:

69243

Description:

Predicted to enable frizzled binding activity and smoothened binding activity. Predicted to be involved in several processes, including labyrinthine layer blood vessel development; maternal placenta development; and protein localization to plasma membrane. Predicted to act upstream of or within several processes, including chordate embryonic development; regulation of gene expression; and regulation of signal transduction. Located in COPI-coated vesicle and zymogen granule membrane. Orthologous to human TMED2 (transmembrane p24 trafficking protein 2); INTERACTS WITH 2-ethoxyethanol; 2-methoxyethanol; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

coated vesicle membrane protein; COPI-coated vesicle membrane protein p24; membrane protein p24A; MGC72390; p24 family protein beta-1; p24beta1; RNP21.4; Rnp24; transmembrane emp24 domain trafficking protein 2; transmembrane emp24 domain-containing protein 2

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	32,052,542 - 32,061,628 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,052,543 - 32,071,903 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,231,743 - 33,240,850 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	33,843,066 - 33,852,174 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	32,894,932 - 32,904,047 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,471,259 - 37,480,344 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,471,260 - 37,480,297 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	39,342,087 - 39,351,163 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,165,291 - 33,174,326 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,028,678 - 33,037,714 (-)	NCBI
Celera	12	33,742,602 - 33,751,640 (-)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Myocardial Ischemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2-ethoxyethanol (EXP)

2-methoxyethanol (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

clofibrate (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cypermethrin (EXP)

dibenzo[a,l]pyrene (ISO)

dimethylarsinous acid (ISO)

diuron (ISO)

dorsomorphin (ISO)

erlotinib hydrochloride (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glyphosate (EXP)

hypochlorous acid (ISO)

ivermectin (ISO)

L-ethionine (EXP)

methidathion (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

monocrotaline (ISO)

N-nitrosodimethylamine (ISO)

nefazodone (EXP)

nimesulide (EXP)

omeprazole (EXP)

ozone (EXP,ISO)

paracetamol (ISO)

phenobarbital (ISO)

pinosylvin (ISO)

pirinixic acid (EXP)

pyrimidifen (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trans-pinosylvin (ISO)

tunicamycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

allantois development (IEA,ISO)

branching involved in labyrinthine layer morphogenesis (IEA,ISO)

chorion development (IEA,ISO)

embryonic morphogenesis (ISO)

embryonic placenta development (ISO)

endoplasmic reticulum membrane organization (IEA,ISO)

endoplasmic reticulum organization (ISO)

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA)

Golgi organization (IBA,IEA,ISO,ISS)

heart looping (IEA,ISO)

in utero embryonic development (ISO)

inflammatory response (IEA,ISO)

intracellular protein transport (IBA,IEA,ISO,NAS)

labyrinthine layer blood vessel development (IEA,ISO)

maintenance of protein localization in organelle (IEA,ISO)

maternal placenta development (IEA,ISO)

multicellular organism growth (IEA,ISO)

negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation (IEA,ISO)

negative regulation of protein localization to plasma membrane (IEA,ISO)

negative regulation of smoothened signaling pathway (IEA,ISO)

neural tube closure (IEA,ISO)

PERK-mediated unfolded protein response (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

post-anal tail morphogenesis (IEA,ISO)

protein localization (ISO)

protein localization to plasma membrane (IEA,ISO,ISS)

protein secretion (IEA,ISO)

regulation of SREBP signaling pathway (IEA,ISO)

somite rostral/caudal axis specification (IEA,ISO)

somitogenesis (ISO)

vesicle targeting (NAS)

Cellular Component

COPI-coated vesicle (IDA,ISS)

COPI-coated vesicle membrane (IEA)

COPII-coated ER to Golgi transport vesicle (IBA)

endoplasmic reticulum (IBA,ISO,ISS)

endoplasmic reticulum membrane (IEA,ISO)

endoplasmic reticulum-Golgi intermediate compartment (IBA,ISO,ISS)

endoplasmic reticulum-Golgi intermediate compartment membrane (IEA)

Golgi apparatus (IBA,IEA,ISO,ISS)

Golgi cisterna membrane (IEA)

intracellular membrane-bounded organelle (ISO)

membrane (IDA)

zymogen granule membrane (IDA)

Molecular Function

frizzled binding (IEA,ISO)

protein binding (IPI,ISO)

smoothened binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Golgi matrix proteins interact with p24 cargo receptors and aid their efficient retention in the Golgi apparatus.	Barr FA, etal., J Cell Biol. 2001 Dec 10;155(6):885-91. Epub 2001 Dec 10.
2.	Tmp21 and p24A, two type I proteins enriched in pancreatic microsomal membranes, are members of a protein family involved in vesicular trafficking.	Blum R, etal., J Biol Chem 1996 Jul 19;271(29):17183-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	p24 and p23, the major transmembrane proteins of COPI-coated transport vesicles, form hetero-oligomeric complexes and cycle between the organelles of the early secretory pathway.	Gommel D, etal., FEBS Lett. 1999 Mar 26;447(2-3):179-85.
5.	p24A, a type I transmembrane protein, controls ARF1-dependent resensitization of protease-activated receptor-2 by influence on receptor trafficking.	Luo W, etal., J Biol Chem. 2007 Oct 12;282(41):30246-55. Epub 2007 Aug 10.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:9472029	PMID:10761932	PMID:11748249	PMID:12237308	PMID:12477932	PMID:15489334	PMID:20178780	PMID:20361938	PMID:20427317	PMID:25002582	PMID:28797121

Genomics

Comparative Map Data

Tmed2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	32,052,542 - 32,061,628 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,052,543 - 32,071,903 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,231,743 - 33,240,850 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	33,843,066 - 33,852,174 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	32,894,932 - 32,904,047 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,471,259 - 37,480,344 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,471,260 - 37,480,297 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	39,342,087 - 39,351,163 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,165,291 - 33,174,326 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,028,678 - 33,037,714 (-)	NCBI
Celera	12	33,742,602 - 33,751,640 (-)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

TMED2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	123,584,552 - 123,598,582 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	123,584,533 - 123,598,582 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	124,069,099 - 124,083,129 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	122,635,029 - 122,648,641 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	122,594,040 - 122,607,561	NCBI
Celera	12	123,665,514 - 123,679,126 (+)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	121,030,441 - 121,044,052 (+)	NCBI		HuRef
CHM1_1	12	123,890,022 - 123,903,633 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	123,583,417 - 123,597,447 (+)	NCBI		T2T-CHM13v2.0

Tmed2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	124,678,835 - 124,688,566 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	124,678,758 - 124,688,569 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	124,540,791 - 124,550,503 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	124,540,695 - 124,550,506 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	124,990,800 - 125,000,512 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	124,801,409 - 124,811,121 (+)	NCBI		MGSCv36	mm8
Celera	5	121,616,969 - 121,626,684 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.65	NCBI

Tmed2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	5,404,739 - 5,415,243 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	5,404,739 - 5,415,243 (-)	NCBI	ChiLan1.0	ChiLan1.0

TMED2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	12	131,655,269 - 131,669,897 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	121,169,915 - 121,183,524 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	125,397,391 - 125,410,799 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	125,397,391 - 125,410,794 (+)	Ensembl	panpan1.1		panPan2

TMED2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,039,046 - 6,047,490 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	6,039,405 - 6,047,459 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,200,941 - 6,210,349 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,288,140 - 6,297,554 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,287,725 - 6,297,549 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,221,613 - 6,231,022 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	6,314,000 - 6,323,406 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,267,212 - 6,276,621 (-)	NCBI		UU_Cfam_GSD_1.0

Tmed2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	158,247,895 - 158,256,138 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	1,223,114 - 1,231,479 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	1,223,114 - 1,258,699 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMED2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	29,390,335 - 29,400,437 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	29,390,903 - 29,400,454 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,082,626 - 31,092,755 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMED2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	118,913,145 - 118,927,335 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	118,913,078 - 118,928,281 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	126,348,858 - 126,363,072 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmed2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	23,389,262 - 23,399,955 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	23,389,262 - 23,399,962 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmed2
63 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	641
Count of miRNA genes:	287
Interacting mature miRNAs:	359
Transcripts:	ENSRNOT00000001397
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat

Markers in Region

RH125644

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,052,579 - 32,052,813 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,471,297 - 37,471,530	NCBI	Rnor6.0
Rnor_5.0	12	39,342,125 - 39,342,358	UniSTS	Rnor5.0
RGSC_v3.4	12	33,165,326 - 33,165,559	UniSTS	RGSC3.4
Celera	12	33,742,637 - 33,742,870	UniSTS
Cytogenetic Map	12	q15	UniSTS

RH124557

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,052,572 - 32,052,747 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,471,290 - 37,471,464	NCBI	Rnor6.0
Rnor_5.0	12	39,342,118 - 39,342,292	UniSTS	Rnor5.0
RGSC_v3.4	12	33,165,319 - 33,165,493	UniSTS	RGSC3.4
Celera	12	33,742,630 - 33,742,804	UniSTS
Cytogenetic Map	12	q15	UniSTS

Tmed2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	57,769,129 - 57,769,525 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	64,327,639 - 64,328,034	NCBI	Rnor6.0
Rnor_5.0	7	64,548,640 - 64,549,035	UniSTS	Rnor5.0
Celera	7	54,951,202 - 54,951,597	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	12	q15	UniSTS

Tmed2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	57,769,182 - 57,769,564 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	64,327,692 - 64,328,073	NCBI	Rnor6.0
Rnor_5.0	7	64,548,693 - 64,549,074	UniSTS	Rnor5.0
Celera	7	54,951,255 - 54,951,636	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	12	q15	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001393805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_031722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229555	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X92097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001397 ⟹ ENSRNOP00000001397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,052,543 - 32,071,903 (-)	Ensembl
Rnor_6.0 Ensembl	12	37,471,260 - 37,480,297 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105841 ⟹ ENSRNOP00000077165

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,052,543 - 32,071,903 (-)	Ensembl

RefSeq Acc Id:

NM_001393805 ⟹ NP_001380734

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	32,052,542 - 32,061,628 (-)	NCBI

RefSeq Acc Id:

NM_031722 ⟹ NP_113910

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	32,052,542 - 32,061,628 (-)	NCBI
Rnor_6.0	12	37,471,262 - 37,480,297 (-)	NCBI
Rnor_5.0	12	39,342,087 - 39,351,163 (-)	NCBI
RGSC_v3.4	12	33,165,291 - 33,174,326 (-)	RGD
Celera	12	33,742,602 - 33,751,640 (-)	RGD

Sequence:

show sequence

CGGCGGCTCTGGAGGCCGCAGTCCGCGTCCCGGCTTCGGCCCGTGCCGCACCATGGTGACGCTC
GCAGAACTGCTGGTGCTGCTGGCCGCGCTGCTGGCCACGGCCTCGGGCTACTTCGTCAGCATCG
ACGCGCACGCCGAGGAGTGCTTCTTCGAGCGGGTCACCTCGGGCACCAAGATGGGCCTCATCTT
CGAGGTGGCGGAGGGCGGCTTCCTGGACATCGACGTGGAGATCACAGGACCAGATAATAAAGGA
ATCTATAAAGGAGACCGGGAGTCCAGCGGGAAGTACACGTTTGCAGCCCACATGGATGGGACAT
ACAAGTTCTGCTTTAGTAATAGGATGTCCACTATGACTCCAAAGATAGTGATGTTCACCATTGA
CATTGGGGAGGCTCCTAAAGGACAAGACATGGAGACAGAAGCTCATCAAAACAAGCTAGAAGAA
ATGATTAATGAGCTGGCAGTGGCCATGACAGCCGTAAAGCACGAACAGGAGTACATGGAAGTCC
GGGAGAGAATACACAGAGCCATCAACGACAACACAAACAGCAGAGTGGTCCTTTGGTCCTTCTT
CGAAGCTCTTGTTCTTGTTGCCATGACATTGGGACAGATCTACTACCTGAAGAGATTTTTTGAA
GTCCGGAGGGTTGTTTAAAAGGCCTTTTCCTATTGATCCCAAATTCATGATTTACTTGTTTACC
AAACACCTTGGTCATAATAATGTCATTAGTTTATACATTTTTATTTTCTGAACGTTCATGACTT
ATGTTTCTTTGTGATTATTAGGTGTTGGGGAAAACCTGTTTAGGAAAGTTAGAGTGAAAATTTG
ACATTTGGTTGGCCTGTAATTCTTACTTGAAAGCAGCCCATGATACAGGTCCTTTCAAGAGTTC
AGAGGCTGTTGATGCTGTATGGGACTATGGTCTTTATTATGTTTTTACCTTTGGTTTTCATAGT
AGAATGCAGTTTTTCCAGGAAGTGCCCACAGCCTGACATACTTGTTAACTAACTGCATTCTAGT
AGTTCCTTGGCTGTGCTTCATCATCAGAGGCTCCTTTTGTTTCTCCAGCAACAGCGATCTGAAT
CTTGACCCTTGTGGCCCCTCCTCAGGGCCAGGAGACCTGATGGGGCATGTTACCAGGGCGGGCA
CTCATACTTTCTCTTGAGTTTGATTTAAAGACTCATCGCACACTTCCCCCTAAAGTTTTATATT
GAACCTTAGAACTGAATCACCTCTAATTGAATTGACACAAGCAGCCAATAACTTAGCCGTCTGT
CGAGTCCAGTTCCCCGGGTGTCAGACAGACAGACTGCTGTCCCTGTGTGCTGCATATCTGTCTG
TTGTTGGCACTCAGGAAGATGGAGTTCCTCACGTGGAAGCCTGCACTTCTCAAGCTAAAGGGTT
AAACCTCTGGGATTGCTTGCAGTGATGGCAGCCACTGTTGTCCTTTTAGTCAGTGGCCTTCGTG
CCCTGGTCTTCAGTGTCAGCAATAGGGTTTATTTGTCCTCTGGGGTCTTTCTTTTTTGGCACAT
GTCAGTTTTGTTTATAAAAGATGAAGAGACTGTCTCTCTGATGATGGGCTTAATGAAAGGCACT
CTGCTTTGGGTGTGGGCGGTCCAGGATTATGTGGTGACTAATGTCTGTTAGTTACCTGGATATT
TTATTTTTATTTTTGGATCTTGCAAGGGGAAAACTACAAGTAACAAGTTTTATAAATTTAATTT
AAATTTGTTACAGGTTTCCATGTTCAGGACAAATAATTTTTCAACCTTCGATGATATCTTGCAA
CAGTTGGTTGGTGACTCTGTCACCCTAGGGCAGCTGTTGCATGCCAATTTTTTTGTGTGTGTAT
GTGTGAAAACACTTCAGAATTGAATTAAAAGATGTAAATTTAAAATCGGTTGTGTATCTAATAT
GCCCCAAGTTCAGTAAATAAACAATTCTTTTTAAAACCAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001380734	(Get FASTA)	NCBI Sequence Viewer
	NP_113910	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH62036	(Get FASTA)	NCBI Sequence Viewer
	CAA63068	(Get FASTA)	NCBI Sequence Viewer
	EDM13577	(Get FASTA)	NCBI Sequence Viewer
	EDM13579	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001397
	ENSRNOP00000077165
	ENSRNOP00000077165.1
GenBank Protein	Q63524	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113910 ⟸ NM_031722
- Peptide Label:	isoform 2 precursor
- UniProtKB:	Q63524 (UniProtKB/Swiss-Prot), A6J0Y7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVTLAELLVLLAALLATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGP DNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQN KLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLK RFFEVRRVV hide sequence

RefSeq Acc Id:

ENSRNOP00000001397 ⟸ ENSRNOT00000001397

RefSeq Acc Id:

ENSRNOP00000077165 ⟸ ENSRNOT00000105841

RefSeq Acc Id:	NP_001380734 ⟸ NM_001393805
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A0A8I5Y5Z9 (UniProtKB/TrEMBL), A6J0Y8 (UniProtKB/TrEMBL)

Protein Domains

GOLD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63524-F1-model_v2	AlphaFold	Q63524	1-201	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698609

Promoter ID:

EPDNEW_R9134

Type:

multiple initiation site

Name:

Tmed2_1

Description:

transmembrane p24 trafficking protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	37,480,334 - 37,480,394	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69243	AgrOrtholog
BioCyc Gene	G2FUF-19358	BioCyc
Ensembl Genes	ENSRNOG00000001053	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001397	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000105841	ENTREZGENE
	ENSRNOT00000105841.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5623841	IMAGE-MGC_LOAD
InterPro	Emp24-like	UniProtKB/TrEMBL
	GOLD_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GOLD_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TMP21-related	UniProtKB/Swiss-Prot
KEGG Report	rno:65165	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72390	IMAGE-MGC_LOAD
NCBI Gene	65165	ENTREZGENE
PANTHER	PTHR22811	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	EMP24_GP25L	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tmed2	PhenoGen
PROSITE	GOLD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001053	RatGTEx
SMART	EMP24_GP25L	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF101576	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC206186
UniProt	A0A8I5Y5Z9	ENTREZGENE, UniProtKB/TrEMBL
	A6J0Y7	ENTREZGENE, UniProtKB/TrEMBL
	A6J0Y8	ENTREZGENE, UniProtKB/TrEMBL
	Q63524	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-19	Tmed2	transmembrane p24 trafficking protein 2	Tmed2	transmembrane emp24 domain trafficking protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Tmed2	transmembrane emp24 domain trafficking protein 2	Rnp24	coated vesicle membrane protein	Symbol and Name updated	1299863	APPROVED
2002-06-10	Rnp24	coated vesicle membrane protein			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD