Advanced Search (OLGA)

Gene: Prss12 (serine protease 12) Rattus norvegicus

Analyze

Symbol:

Prss12

Name:

serine protease 12

RGD ID:

69238

Description:

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in exocytosis. Predicted to act upstream of or within zymogen activation. Predicted to be located in several cellular components, including axon; cytoplasmic vesicle; and synapse. Predicted to be active in several cellular components, including Schaffer collateral - CA1 synapse; glutamatergic synapse; and synaptic cleft. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder 1 and intellectual disability. Orthologous to human PRSS12 (serine protease 12); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

neurotrypsin; Nt; peptidase, serine, 12 (neurotrypsin, motopsin); protease serine 12 neurotrypsin (motopsin); protease, serine 12; protease, serine, 12; protease, serine, 12 neurotrypsin (motopsin); protease, serine, 12 neurotrypsin, (motopsin)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRSS12 (serine protease 12)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Prss12 (serine protease 12 neurotrypsin (motopsin))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prss12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRSS12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRSS12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prss12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRSS12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRSS12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prss12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Prss12 (serine protease 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CD6 (CD6 molecule)	HGNC	Treefam
Alliance orthologs ³
Homo sapiens (human):	PRSS12 (serine protease 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prss12 (serine protease 12 neurotrypsin (motopsin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prss12 (serine protease 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prss12 (serine protease 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	svh-1	Alliance	DIOPT (Hieranoid\|InParanoid)
Drosophila melanogaster (fruit fly):	teq	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	teq	Alliance	DIOPT (OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prss12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Eau5

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	214,308,695 - 214,368,679 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	214,308,774 - 214,369,941 (+)	Ensembl				GRCr8
mRatBN7.2	2	211,624,134 - 211,684,126 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	211,624,134 - 211,684,126 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	219,299,258 - 219,359,183 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	217,199,129 - 217,259,048 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	212,053,382 - 212,113,300 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	227,657,983 - 227,717,884 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	227,657,983 - 227,717,884 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	247,015,139 - 247,074,636 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	220,194,590 - 220,254,502 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	204,036,064 - 204,095,891 (+)	NCBI		Celera
RGSC_v3.1	2	220,157,651 - 220,217,564 (+)	NCBI
Cytogenetic Map	2	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive intellectual developmental disorder 1 (ISO)

intellectual disability (ISO)

long QT syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP,ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

bucladesine (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

carmustine (ISO)

chlorpyrifos (ISO)

chrysene (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenzo[a,l]pyrene (ISO)

diiodine (ISO)

dimethylarsinous acid (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

indometacin (ISO)

irinotecan (ISO)

lead diacetate (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

medroxyprogesterone acetate (ISO)

mercury dibromide (ISO)

methylparaben (ISO)

miconazole (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP)

phenethyl caffeate (EXP)

phenylmercury acetate (ISO)

phenytoin (ISO)

potassium chromate (ISO)

resveratrol (ISO)

sarin (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

testosterone (EXP)

tetraphene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

exocytosis (ISO,ISS)

proteolysis (IEA,ISO)

zymogen activation (ISO)

Cellular Component

axon (ISO,ISS)

cytoplasmic vesicle (ISO)

dendrite (IBA,ISO)

extracellular region (IEA)

glutamatergic synapse (IEA,ISO)

membrane (IEA)

plasma membrane (ISO,ISS)

presynapse (IEA,ISO)

Schaffer collateral - CA1 synapse (ISO)

synapse (ISO)

synaptic cleft (IBA,ISO)

terminal bouton (IBA,ISO)

Molecular Function

hydrolase activity (IEA)

peptidase activity (IEA,ISO)

serine-type endopeptidase activity (IEA,ISO)

serine-type peptidase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Neurotrypsin, a novel multidomain serine protease expressed in the nervous system.	Gschwend TP, etal., Mol Cell Neurosci 1997;9(3):207-19.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Truncating neurotrypsin mutation in autosomal recessive nonsyndromic mental retardation.	Molinari F, etal., Science 2002 Nov 29;298(5599):1779-81.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17223089	PMID:17586728	PMID:18230682	PMID:18272678	PMID:18956887

Genomics

Comparative Map Data

Prss12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	214,308,695 - 214,368,679 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	214,308,774 - 214,369,941 (+)	Ensembl				GRCr8
mRatBN7.2	2	211,624,134 - 211,684,126 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	211,624,134 - 211,684,126 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	219,299,258 - 219,359,183 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	217,199,129 - 217,259,048 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	212,053,382 - 212,113,300 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	227,657,983 - 227,717,884 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	227,657,983 - 227,717,884 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	247,015,139 - 247,074,636 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	220,194,590 - 220,254,502 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	204,036,064 - 204,095,891 (+)	NCBI		Celera
RGSC_v3.1	2	220,157,651 - 220,217,564 (+)	NCBI
Cytogenetic Map	2	q42	NCBI

PRSS12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	118,280,038 - 118,353,003 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	118,280,038 - 118,353,003 (-)	Ensembl			hg38	GRCh38
GRCh37	4	119,201,193 - 119,274,158 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	119,421,865 - 119,493,370 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	119,560,019 - 119,631,525	NCBI
Celera	4	116,492,317 - 116,565,055 (-)	NCBI		Celera
Cytogenetic Map	4	q26	NCBI
HuRef	4	114,936,619 - 115,009,040 (-)	NCBI		HuRef
CHM1_1	4	119,177,431 - 119,250,161 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	121,585,014 - 121,657,983 (-)	NCBI		T2T-CHM13v2.0

Prss12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	123,240,562 - 123,300,251 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	123,240,562 - 123,300,246 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	123,446,913 - 123,506,602 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	123,446,913 - 123,506,597 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	123,149,831 - 123,209,520 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	123,438,935 - 123,498,619 (+)	NCBI		MGSCv36	mm8
Celera	3	129,878,310 - 129,935,827 (+)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	54.58	NCBI

Prss12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	21,574,947 - 21,644,539 (+)	Ensembl
ChiLan1.0	NW_004955428	21,574,947 - 21,644,909 (+)	NCBI	ChiLan1.0	ChiLan1.0

PRSS12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	116,316,460 - 116,391,208 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	116,613,235 - 116,687,963 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	110,727,731 - 110,801,258 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	121,279,868 - 121,352,783 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	121,279,868 - 121,353,151 (-)	Ensembl			panPan2	panpan1.1

PRSS12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	37,509,662 - 37,586,933 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	37,509,124 - 37,587,155 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	4,487,268 - 4,564,942 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	37,730,129 - 37,808,285 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	37,730,142 - 37,808,489 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	37,753,268 - 37,831,362 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	37,476,304 - 37,554,549 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	2,249,097 - 2,327,432 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prss12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	67,819,767 - 67,846,476 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936869	651,373 - 711,168 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRSS12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	105,121,529 - 105,197,141 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	105,121,529 - 105,197,142 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	112,836,262 - 112,911,646 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRSS12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	66,027,172 - 66,101,563 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	66,025,613 - 66,101,549 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	44,859,539 - 44,939,830 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prss12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624867	5,338,463 - 5,451,160 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624867	5,341,202 - 5,450,977 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prss12
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	36,295,245 - 36,355,698 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Prss12
414 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	26
Interacting mature miRNAs:	26
Transcripts:	ENSRNOT00000021116
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	212145502	231732847	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
1302789	Stl26	Serum triglyceride level QTL 26	3.1	0.0035	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	206613059	226891081	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
631203	Gluco14	Glucose level QTL 14		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	2	209350500	221678003	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	205135267	225627153	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat

Markers in Region

D2Rat242

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	214,358,556 - 214,358,774 (+)	Marker Load Pipeline
mRatBN7.2	2	211,674,003 - 211,674,221 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	227,707,762 - 227,707,979	NCBI	Rnor6.0
Rnor_5.0	2	247,064,514 - 247,064,731	UniSTS	Rnor5.0
RGSC_v3.4	2	220,244,380 - 220,244,597	UniSTS	RGSC3.4
RGSC_v3.4	2	220,244,379 - 220,244,597	RGD	RGSC3.4
Celera	2	204,085,769 - 204,085,986	UniSTS
RGSC_v3.1	2	220,207,441 - 220,207,659	RGD
SHRSP x BN Map	2	83.0098	RGD
SHRSP x BN Map	2	83.0098	UniSTS
Cytogenetic Map	2	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	66	135	91	90	59	34	59	6	297	133	11	114	81	92	31	10	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ311671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021116 ⟹ ENSRNOP00000021116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	214,308,774 - 214,369,941 (+)	Ensembl
mRatBN7.2 Ensembl	2	211,624,134 - 211,684,126 (+)	Ensembl
Rnor_6.0 Ensembl	2	227,657,983 - 227,717,884 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000152798 ⟹ ENSRNOP00000108405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	214,308,774 - 214,369,941 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000173910 ⟹ ENSRNOP00000111634

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	214,308,774 - 214,369,941 (+)	Ensembl

RefSeq Acc Id:

NM_053504 ⟹ NP_445956

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	214,308,695 - 214,368,679 (+)	NCBI
mRatBN7.2	2	211,624,134 - 211,684,126 (+)	NCBI
Rnor_6.0	2	227,657,983 - 227,717,884 (+)	NCBI
Rnor_5.0	2	247,015,139 - 247,074,636 (+)	NCBI
RGSC_v3.4	2	220,194,590 - 220,254,502 (+)	RGD
Celera	2	204,036,064 - 204,095,891 (+)	RGD

Sequence:

show sequence

CCAGCCTTTGCTTCGAGGGGCTGACCCTTCGGGTCCCGGTGTGATTCTCCAGCCGCCCTAGGGG
CCCGGACAGCAGGGCGGCGGCGCGAGCGTGGGAGGGGGCTCTAGGACTCTGCCCGCCCCGCCCC
GCCCCCTCCGCGGGGACCCGGAGCCCAGCATGGACCACACTCGGCGCCGCAGCCATGGCGCTCG
CCCGCTGCGTGCTGGCTGTGATTTTAGGGGTACTGTCCGAAGTGGCCCGCGCTGATCCGGTCTT
GCACTCGCCCCTGCACCGCCCGCATCCGTCTCCACCGCGTTCCCAACACGCGCATTACCTTCCC
AGCTCGCGGCGGCCACCCAGGACCCCGCGCTTCCCGCTCCCGCCGCGGGCCCCCGCTGCCCAGC
GCCCTCAGCTCCTCAGCACCCGGCACACGCCCCCGACGATTTCACGCCGGTGCGGGGCTGGAGA
GCCCTGGGGCAATGCCACCAACCTCGGCGTCCCGTGTCTACACTGGGACGAGGTGCCGCCCTTC
CTGGAGCGGTCGCCCCCGGCCAGTTGGGCTGAGCTAAGAGGGCAGCCGCACAACTTCTGCCGGA
GTCCGGATGGCGCGGGCAGACCTTGGTGCTTCTATCGAAATGCCCAAGGCAAAGTGGACTGGGG
CTACTGCGATTGTGGTCAAGGCCCCGCGCTGCCTGTCATTCGCCTTGTTGGTGGGAAGAGTGGG
CACGAAGGTCGAGTGGAGCTGTACCACGCTGGCCAATGGGGAACCATCTGTGATGACCAATGGG
ACGACGCAGATGCAGAAGTCATCTGCAGGCAGCTGGGTCTCAGTGGCATTGCCAAAGCATGGCA
TCAGGCACATTTTGGGGAAGGATCTGGCCCAATATTGTTGGATGAAGTACGCTGCACTGGGAAT
GAGCTGTCAATTGAGCAGTGTCCAAAGAGCTCCTGGGGTGAACATAACTGTGGCCATAAAGAAG
ATGCCGGAGTGTCTTGTGCTCCTCTGACAGATGGTGTCATCAGACTGTCAGGAGGGAAAAGTGT
CCATGAAGGTCGCTTGGAGGTGTACTATAGGGGACAGTGGGGAACAGTTTGTGATGATGGCTGG
ACTGAAATGAATACATACGTGGCTTGTCGACTGCTGGGATTTAAATATGGCAAACAGTCCTCTG
TGAACCACTTTGAAGGCAGCAGCAGGCCCATATGGCTGGATGACGTCAGCTGCTCAGGAAAAGA
AGCCAGCTTCATTCAGTGTTCCAGGAGACAGTGGGGAAGGCATGACTGCAGCCATAGGGAAGAT
GTGGGCCTCACCTGCTACCCTGACAGTGATGGTCATAGGCTTTCCCCAGGTTTTCCTATCAGAC
TAATGGACGGAGAGAATAAGAGAGAAGGACGAGTGGAGGTTTTTGTCAATGGCCAATGGGGAAC
GATCTGCGATGATGGATGGACCGACAAGCATGCAGCTGTGATTTGCCGGCAGCTTGGCTATAAG
GGTCCGGCCAGGGCGAGGACCATGGCTTATTTTGGGGAAGGAAAAGGCCCCATCCACATGGACA
ATGTGAAGTGCACAGGGAATGAGAAGGCCCTGGCCGACTGCGTCAAACAAGACATCGGAAGGCA
CAACTGCCGCCACAGTGAGGACGCAGGAGTCATCTGTGACTATTACGAGAAAAAAACATCAGGT
CATGGGAATAAAGAGACCCTCTCATCTGGGTGTGGATTGAGATTACTACACCGCCGACAGACAC
GGATCATTGGTGGGAACAATTCTTTAAGGGGTGCCTGGCCTTGGCAGGCTTCCCTCAGGCTGAA
GTCGACCCACGGAGATGGCAGGCTGCTCTGTGGAGCCACCCTTCTAAGTAGCTGCTGGGTCCTG
ACAGCTGCGCACTGTTTCACAAGGTACGGTAACAACTCGAGGAGTTATGCCGTCCGAGTTGGCG
ATTATCATACTTTGGTTCCCGAGGGGTTTGAACAAGACATAGGGGTCCAACAGATTGTGATTCA
CAGGAACTATCGGCCAGACAGCAGCGACTATGACATCGCCCTGGTCAGATTACAAGGCTCAGGG
GAGCAATGTGCCAGACTAAGCACCCACGTTTTGCCAGCCTGTTTACCTCTATGGAGAGAAAGGC
CACAGAAAACAGCCTCCAACTGTCACATAACAGGATGGGGAGACACAGGTCGTGCTTACTCAAG
AACTCTACAACAAGCAGCTGTGCCTTTGTTACCCAAGAGGTTTTGTAAGGAACGTTACAAGGGA
CTGTTTACTGGGAGAATGCTCTGTGCTGGAAACCTCCAAGAAGACAACCGTGTGGACAGCTGCC
AGGGAGACAGCGGAGGACCACTTATGTGTGAAAAGCCCGATGAAACTTGGGTTGTGTATGGGGT
GACTTCCTGGGGGTACGGATGCGGAATCAAAGACACTCCAGGAGTTTATACCAGAGTCCCTGCC
TTTGTACCTTGGATAAAAAGTGTTACGAGTCTGTAATTTATGGGAAGCTCAAGAAAAAGAGTAA
AGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_445956	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAC35028	(Get FASTA)	NCBI Sequence Viewer
	EDL82129	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021116
	ENSRNOP00000021116.3
GenBank Protein	G3V801	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_445956 ⟸ NM_053504
- Peptide Label:	precursor
- UniProtKB:	Q99JC8 (UniProtKB/Swiss-Prot), G3V801 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MALARCVLAVILGVLSEVARADPVLHSPLHRPHPSPPRSQHAHYLPSSRRPPRTPRFPLPPRAP AAQRPQLLSTRHTPPTISRRCGAGEPWGNATNLGVPCLHWDEVPPFLERSPPASWAELRGQPHN FCRSPDGAGRPWCFYRNAQGKVDWGYCDCGQGPALPVIRLVGGKSGHEGRVELYHAGQWGTICD DQWDDADAEVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCG HKEDAGVSCAPLTDGVIRLSGGKSVHEGRLEVYYRGQWGTVCDDGWTEMNTYVACRLLGFKYGK QSSVNHFEGSSRPIWLDDVSCSGKEASFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGF PIRLMDGENKREGRVEVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPI HMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVICDYYEKKTSGHGNKETLSSGCGLRLLHR RQTRIIGGNNSLRGAWPWQASLRLKSTHGDGRLLCGATLLSSCWVLTAAHCFTRYGNNSRSYAV RVGDYHTLVPEGFEQDIGVQQIVIHRNYRPDSSDYDIALVRLQGSGEQCARLSTHVLPACLPLW RERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRV DSCQGDSGGPLMCEKPDETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIKSVTSL hide sequence

Ensembl Acc Id:

ENSRNOP00000021116 ⟸ ENSRNOT00000021116

Ensembl Acc Id:

ENSRNOP00000111634 ⟸ ENSRNOT00000173910

Ensembl Acc Id:

ENSRNOP00000108405 ⟸ ENSRNOT00000152798

Protein Domains

Kringle Peptidase S1 SRCR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V801-F1-model_v2	AlphaFold	G3V801	1-761	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691734

Promoter ID:

EPDNEW_R2259

Type:

multiple initiation site

Name:

Prss12_1

Description:

protease, serine 12

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	227,658,147 - 227,658,207	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69238	AgrOrtholog
BioCyc Gene	G2FUF-51321	BioCyc
Ensembl Genes	ENSRNOG00000015353	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021116	ENTREZGENE
	ENSRNOT00000021116.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot
	2.40.20.10	UniProtKB/Swiss-Prot
	3.10.250.10	UniProtKB/Swiss-Prot
InterPro	Kringle	UniProtKB/Swiss-Prot
	Kringle-like	UniProtKB/Swiss-Prot
	Kringle_CS	UniProtKB/Swiss-Prot
	Kringle_sf	UniProtKB/Swiss-Prot
	Peptidase_S1_PA	UniProtKB/Swiss-Prot
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot
	Peptidase_S1A	UniProtKB/Swiss-Prot
	SRCR	UniProtKB/Swiss-Prot
	SRCR-like_dom_sf	UniProtKB/Swiss-Prot
	Trypsin_dom	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
KEGG Report	rno:85266	UniProtKB/Swiss-Prot
NCBI Gene	85266	ENTREZGENE
PANTHER	DELETED IN MALIGNANT BRAIN TUMORS 1 PROTEIN	UniProtKB/Swiss-Prot
	SCAVENGER RECEPTOR DOMAIN-CONTAINING	UniProtKB/Swiss-Prot
Pfam	SRCR	UniProtKB/Swiss-Prot
	Trypsin	UniProtKB/Swiss-Prot
PhenoGen	Prss12	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot
	SPERACTRCPTR	UniProtKB/Swiss-Prot
PROSITE	KRINGLE_1	UniProtKB/Swiss-Prot
	KRINGLE_2	UniProtKB/Swiss-Prot
	SRCR_1	UniProtKB/Swiss-Prot
	SRCR_2	UniProtKB/Swiss-Prot
	TRYPSIN_DOM	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015353	RatGTEx
SMART	SM00130	UniProtKB/Swiss-Prot
	SM00202	UniProtKB/Swiss-Prot
	Tryp_SPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot
	SSF56487	UniProtKB/Swiss-Prot
	SSF57440	UniProtKB/Swiss-Prot
UniProt	A0ABK0LQU3_RAT	UniProtKB/TrEMBL
	A0ABK0M9M9_RAT	UniProtKB/TrEMBL
	G3V801	ENTREZGENE, UniProtKB/Swiss-Prot
	Q99JC8	ENTREZGENE
UniProt Secondary	Q99JC8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-01-26	Prss12	serine protease 12	Prss12	protease, serine 12	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-30	Prss12	protease, serine 12	Prss12	protease, serine, 12 neurotrypsin (motopsin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-17	Prss12	protease, serine, 12 neurotrypsin (motopsin)	Prss12	peptidase, serine, 12 (neurotrypsin, motopsin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Prss12	peptidase, serine, 12 (neurotrypsin, motopsin)		protease, serine, 12	Name updated	1299863	APPROVED
2002-06-10	Prss12	protease, serine, 12			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM