Nfix (nuclear factor I X) - Rat Genome Database

Name: Nfix
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nfix (nuclear factor I X) Rattus norvegicus

Analyze

Symbol:

Nfix

Name:

nuclear factor I X

RGD ID:

69080

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in several processes, including atrioventricular canal morphogenesis; endochondral ossification; and nervous system development. Predicted to act upstream of or within several processes, including learning or memory; myeloid leukocyte differentiation; and nervous system development. Predicted to be located in nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Marshall-Smith syndrome and Sotos syndrome 2. Orthologous to human NFIX (nuclear factor I X); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

NF1-X1 protein; Nf1x; nuclear factor 1 X; nuclear factor 1 X-type; nuclear factor I/X; nuclear factor I/X (CCAAT-binding transcription factor)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NFIX (nuclear factor I X)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Nfix (nuclear factor I/X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nfix (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NFIX (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NFIX (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nfix (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NFIX (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NFIX (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nfix (nuclear factor I X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NFIB (nuclear factor I B)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	NFIX (nuclear factor I X)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nfix (nuclear factor I/X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nfixa (nuclear factor I/Xa)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	nfixb (nuclear factor I/Xb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	nfi-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	NfI	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nfix	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	23,355,388 - 23,450,360 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,355,498 - 23,448,265 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,178,323 - 30,271,128 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,832,693 - 30,925,505 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,055,373 - 33,148,200 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,818,640 - 25,914,777 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,821,780 - 25,914,696 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,794,504 - 36,890,430 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	25,018,352 - 25,111,367 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	25,023,177 - 25,097,311 (+)	NCBI
Celera	19	22,941,014 - 23,001,968 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alpha-mannosidosis (ISO)

Charcot-Marie-Tooth disease dominant intermediate B (ISO)

episodic ataxia type 2 (ISO)

genetic disease (ISO)

glutaric acidemia I (ISO)

intellectual disability (ISO)

laryngomalacia (ISO)

Marfanoid Mental Retardation Syndrome, Autosomal (ISO)

Marshall-Smith syndrome (ISO)

Scheuermann's disease (ISS)

Sotos syndrome 2 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrobenzenesulfonic acid (ISO)

2,4-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (EXP,ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amosite asbestos (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bosentan (ISO)

buta-1,3-diene (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

carmustine (ISO)

chloroprene (EXP)

chlorpyrifos (EXP)

choline (ISO)

cisplatin (ISO)

copper(II) chloride (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

dichromium trioxide (ISO)

dicrotophos (ISO)

diuron (EXP)

doxorubicin (EXP,ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

fenthion (ISO)

fenvalerate (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gamma-hexachlorocyclohexane (EXP)

gentamycin (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methidathion (ISO)

methotrexate (ISO)

methoxychlor (EXP,ISO)

N-ethyl-N-nitrosourea (EXP)

nickel atom (ISO)

niclosamide (ISO)

p-toluidine (EXP)

paracetamol (EXP)

PCB138 (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phosgene (ISO)

pirinixic acid (ISO)

poly(vinylpyrrolidone) (EXP)

procymidone (EXP)

progesterone (ISO)

propiconazole (ISO)

resveratrol (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (EXP)

silver(0) (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

succimer (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP,ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte differentiation (ISO)

atrioventricular canal morphogenesis (ISO)

bone mineralization (ISO)

brain development (ISO)

brain morphogenesis (ISO)

camera-type eye development (ISO)

cell maturation (ISO)

cell morphogenesis (ISO)

cell proliferation in forebrain (ISO)

cellular response to BMP stimulus (ISO)

cerebellar cortex morphogenesis (ISO)

cerebellar granule cell differentiation (ISO)

cerebellar Purkinje cell layer development (ISO)

cerebellum development (ISO)

cerebral cortex development (ISO)

collateral sprouting (ISO)

DNA replication (IEA)

ear development (ISO)

endochondral ossification (ISO)

epithelium development (ISO)

exit from mitosis (ISO)

forebrain development (ISO)

forebrain radial glial cell differentiation (ISO)

gene expression (ISO)

generation of neurons (ISO)

glial cell development (ISO)

glial cell fate specification (ISO)

glial cell proliferation (ISO)

gliogenesis (ISO)

hippocampus development (ISO)

homeostasis of number of cells within a tissue (ISO)

inflammatory response (ISO)

lateral ventricle development (ISO)

learning (ISO)

macrophage differentiation (ISO)

memory (ISO)

multicellular organism growth (ISO)

negative regulation of neuron apoptotic process (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

neural precursor cell proliferation (ISO)

neuroblast differentiation (ISO)

neuroblast migration (ISO)

neuroblast proliferation (ISO)

neurogenesis (ISO)

neuron differentiation (ISO)

neuron fate specification (ISO)

olfactory bulb development (ISO)

oligodendrocyte differentiation (ISO)

osteoclast differentiation (ISO)

osteoclast proliferation (ISO)

phagocytosis (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regeneration (ISO)

regulation of transcription by RNA polymerase II (IBA)

response to wounding (ISO)

retina development in camera-type eye (ISO)

Rho protein signal transduction (ISO)

skeletal muscle satellite cell differentiation (ISO)

skeletal muscle tissue development (ISO)

skeletal muscle tissue regeneration (ISO)

skeletal system development (ISO)

social behavior (ISO)

spinal cord development (ISO)

stem cell population maintenance (ISO)

tissue homeostasis (ISO)

transcription by RNA polymerase II (ISO)

Cellular Component

nucleoplasm (ISO)

nucleus (IBA,ISO)

Molecular Function

chromatin binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of NFI-binding sites and cloning of NFI-cDNAs suggest a regulatory role for NFI transcription factors in olfactory neuron gene expression.	Baumeister H, etal., Brain Res Mol Brain Res 1999 Sep 8;72(1):65-79.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	Expression, DNA-binding specificity and transcriptional regulation of nuclear factor 1 family proteins from rat.	Osada S, etal., Biochem J 1999 Aug 15;342 ( Pt 1)(21):189-98.
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.	Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35

Additional References at PubMed

PMID:9056636	PMID:9660824	PMID:16147868	PMID:16204235	PMID:19706729	PMID:21800304	PMID:24895400	PMID:33633191

Genomics

Comparative Map Data

Nfix
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	23,355,388 - 23,450,360 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,355,498 - 23,448,265 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,178,323 - 30,271,128 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,832,693 - 30,925,505 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,055,373 - 33,148,200 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,818,640 - 25,914,777 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,821,780 - 25,914,696 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,794,504 - 36,890,430 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	25,018,352 - 25,111,367 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	25,023,177 - 25,097,311 (+)	NCBI
Celera	19	22,941,014 - 23,001,968 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

NFIX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	12,995,475 - 13,098,796 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	12,995,475 - 13,098,796 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	13,106,289 - 13,209,610 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,967,584 - 13,070,610 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	12,967,583 - 13,070,610	NCBI
Celera	19	12,996,993 - 13,100,014 (+)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,707,303 - 12,782,249 (+)	NCBI		HuRef
CHM1_1	19	13,107,626 - 13,210,624 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	13,120,686 - 13,224,010 (+)	NCBI		T2T-CHM13v2.0

Nfix
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,431,341 - 85,527,086 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	85,426,505 - 85,526,973 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	84,704,712 - 84,801,238 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,699,876 - 84,800,344 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,231,498 - 87,324,239 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,598,719 - 87,690,245 (-)	NCBI		MGSCv36	mm8
Celera	8	89,007,669 - 89,082,215 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.02	NCBI

Nfix
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	32,055,375 - 32,117,833 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	32,055,926 - 32,121,611 (+)	NCBI	ChiLan1.0	ChiLan1.0

NFIX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	19	16,924,649 - 17,027,957 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	12,557,020 - 12,660,316 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	13,315,482 - 13,402,406 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,327,690 - 13,402,406 (+)	Ensembl	panpan1.1		panPan2

NFIX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	49,117,087 - 49,187,023 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	49,117,943 - 49,214,788 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	48,989,635 - 49,094,158 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,634,123 - 49,738,501 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,635,376 - 49,703,891 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	48,845,676 - 48,949,981 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	49,272,022 - 49,376,246 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,514,448 - 49,619,003 (-)	NCBI		UU_Cfam_GSD_1.0

Nfix
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,221,747 - 208,289,349 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	2,065,458 - 2,136,889 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936659	2,065,410 - 2,136,898 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NFIX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	65,954,811 - 66,056,567 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	65,954,808 - 66,056,591 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,321,736 - 66,402,215 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NFIX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	11,705,323 - 11,778,943 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	11,706,060 - 11,776,083 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	8,003,657 - 8,106,509 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nfix
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	550,931 - 646,417 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624901	551,277 - 645,435 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nfix
251 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	32
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000039354
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat

Markers in Region

NFIX

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	19	36,862,093 - 36,862,339	NCBI	Rnor5.0
RGSC_v3.4	19	25,046,645 - 25,046,890	UniSTS	RGSC3.4
Celera	19	22,941,188 - 22,941,433	UniSTS
Cytogenetic Map	19	q11	UniSTS

UniSTS:474756

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	23,383,435 - 23,383,753 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	25,886,456 - 25,886,773	NCBI	Rnor6.0
Rnor_5.0	19	36,862,079 - 36,862,396	UniSTS	Rnor5.0
RGSC_v3.4	19	25,046,588 - 25,046,905	UniSTS	RGSC3.4
Celera	19	22,941,131 - 22,941,448	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	33	30	20	12	20	8	11	64	24	32	11	8
Low	1	8	27	21	7	21			8	11	6
Below cutoff		2							2		3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_030866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255307	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB012234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB012235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC120246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF112459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000039354 ⟹ ENSRNOP00000034591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,355,498 - 23,448,265 (+)	Ensembl
Rnor_6.0 Ensembl	19	25,821,949 - 25,914,696 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000091994 ⟹ ENSRNOP00000071775

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,381,795 - 23,448,265 (+)	Ensembl
Rnor_6.0 Ensembl	19	25,821,780 - 25,914,689 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101795 ⟹ ENSRNOP00000082587

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,381,795 - 23,448,265 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117437 ⟹ ENSRNOP00000096564

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,383,097 - 23,448,265 (+)	Ensembl

RefSeq Acc Id:

NM_030866 ⟹ NP_110493

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,355,498 - 23,448,273 (+)	NCBI
Rnor_6.0	19	25,821,941 - 25,914,696 (-)	NCBI
Rnor_5.0	19	36,794,504 - 36,890,430 (-)	NCBI
RGSC_v3.4	19	25,018,352 - 25,111,367 (+)	RGD
Celera	19	22,941,014 - 23,001,968 (+)	RGD

Sequence:

show sequence

CCGCGGCCGGCCTCTGCGCTCGCGCCCGGGCGCCCAGCGATGTACTCCCCGTACTGCCTCACCC
AGGATGAGTTCCACCCGTTCATCGAGGCGCTGCTGCCTCACGTCCGAGCCTTCTCCTACACCTG
GTTCAACCTGCAGGCGCGGAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGGATGTCAAAGGAC
GAGGAGCGCGCAGTGAAGGACGAGCTGCTGGGCGAGAAGCCTGAGATCAAGCAGAAGTGGGCAT
CCCGGCTGTTGGCCAAGCTGCGCAAAGACATCCGGCCCGAGTTCCGCGAGGACTTTGTGCTAAC
CATCACGGGCAAGAAGCCCCCCTGCTGCGTGCTCTCCAACCCCGACCAGAAGGGCAAGATCCGG
CGGATTGACTGCCTGCGCCAGGCTGACAAGGTGTGGCGGCTGGACCTGGTCATGGTGATTTTGT
TTAAAGGGATCCCTTTGGAAAGTACTGATGGGGAGCGGCTCTACAAGTCGCCCCAGTGCTCGAA
CCCCGGCCTGTGCGTCCAGCCACATCACATTGGAGTCACAATCAAAGAACTGGACCTTTATCTG
GCTTACTTTGTCCACACTCCGGAATCCGGACAATCAGATAGTTCAAACCAGCAAGGAGATGCGG
ACATCAAACCACTGCCCAACGGGCACTTAAGTTTCCAGGACTGCTTTGTGACGTCTGGGGTCTG
GAACGTGACAGAGCTGGTGAGAGTGTCACAGACTCCTGTTGCAACTGCATCAGGGCCCAACTTC
TCACTGGCAGATCTGGAGAGCCCCAGTTACTACAACATAAATCAAGTGACCCTGGGACGCCGGT
CCATCACCTCCCCTCCTTCCACCAGCACCACCAAGCGCCCCAAGTCCATCGACGACAGTGAGAT
GGAGAGTCCAGTCGATGATGTATTCTATCCTGGGACAGGCCGCTCCCCAGCAGCTGGCAGCAGC
CAGTCTAGCGGATGGCCCAACGACGTGGATGCAGGCCCTGCTTCTCTAAAGAAGTCAGGAAAGC
TGGACTTCTGCAGCGCCCTCTCCTCTCAGGGCAGCTCCCCACGCATGGCTTTCACCCACCACCC
GCTGCCTGTGCTTGCTGGAGTCAGACCAGGGAGCCCCCGGGCCACAGCATCAGCACTGCACTTC
CCTTCCACCTCCATCATTCAGCAGTCGAGCCCGTACTTCACACACCCAACCATCCGCTACCACC
ACCACCATGGGCAGGACTCGCTGAAGGAGTTCGTACAGTTTGTGTGCTCTGACGGCTCGGGTCA
GGCCACCGGGCAGCATTCACAACGACAGGCGCCTCCTCTGCCAACCGGTTTGTCAGCATCGGAT
CCCGGGACAGCAACTTTCTGAACATCCCACAGCAGTCTCAGTCCTGGTTCCTCTGATTAAGATC
AACAAAGAAACAACAAAATTTTAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039098010 ⟹ XP_038953938

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,382,405 - 23,444,145 (+)	NCBI

RefSeq Acc Id:

XM_039098011 ⟹ XP_038953939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,382,424 - 23,450,360 (+)	NCBI

RefSeq Acc Id:

XM_039098012 ⟹ XP_038953940

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,382,389 - 23,444,145 (+)	NCBI

RefSeq Acc Id:

XM_039098013 ⟹ XP_038953941

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,382,826 - 23,448,346 (+)	NCBI

RefSeq Acc Id:

XM_039098014 ⟹ XP_038953942

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,382,826 - 23,444,145 (+)	NCBI

RefSeq Acc Id:

XM_039098015 ⟹ XP_038953943

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,355,388 - 23,444,145 (+)	NCBI

RefSeq Acc Id:

XM_039098016 ⟹ XP_038953944

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,381,807 - 23,444,145 (+)	NCBI

RefSeq Acc Id:

XM_039098017 ⟹ XP_038953945

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,382,826 - 23,448,346 (+)	NCBI

RefSeq Acc Id:

XM_039098018 ⟹ XP_038953946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,379,782 - 23,444,145 (+)	NCBI

RefSeq Acc Id:

XM_039098019 ⟹ XP_038953947

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	23,375,303 - 23,444,145 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_110493	(Get FASTA)	NCBI Sequence Viewer
	XP_038953938	(Get FASTA)	NCBI Sequence Viewer
	XP_038953939	(Get FASTA)	NCBI Sequence Viewer
	XP_038953940	(Get FASTA)	NCBI Sequence Viewer
	XP_038953941	(Get FASTA)	NCBI Sequence Viewer
	XP_038953942	(Get FASTA)	NCBI Sequence Viewer
	XP_038953943	(Get FASTA)	NCBI Sequence Viewer
	XP_038953944	(Get FASTA)	NCBI Sequence Viewer
	XP_038953945	(Get FASTA)	NCBI Sequence Viewer
	XP_038953946	(Get FASTA)	NCBI Sequence Viewer
	XP_038953947	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF23588	(Get FASTA)	NCBI Sequence Viewer
	BAA25294	(Get FASTA)	NCBI Sequence Viewer
	BAA25295	(Get FASTA)	NCBI Sequence Viewer
	EDL92202	(Get FASTA)	NCBI Sequence Viewer
	EDL92203	(Get FASTA)	NCBI Sequence Viewer
	EDL92204	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_110493 ⟸ NM_030866

- UniProtKB:

F2Z3R4 (UniProtKB/TrEMBL), O70189 (UniProtKB/TrEMBL), O70190 (UniProtKB/TrEMBL), A6IY74 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEK
PEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWR
LDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSD
SSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNI
NQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGP
ASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYF
THPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASDPGTATF

hide sequence

RefSeq Acc Id:

ENSRNOP00000071775 ⟸ ENSRNOT00000091994

RefSeq Acc Id:

ENSRNOP00000034591 ⟸ ENSRNOT00000039354

RefSeq Acc Id:	XP_038953943 ⟸ XM_039098015
- Peptide Label:	isoform X5
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953947 ⟸ XM_039098019
- Peptide Label:	isoform X8
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953946 ⟸ XM_039098018
- Peptide Label:	isoform X8
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953944 ⟸ XM_039098016
- Peptide Label:	isoform X6
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953940 ⟸ XM_039098012
- Peptide Label:	isoform X3
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953938 ⟸ XM_039098010
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953939 ⟸ XM_039098011
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953941 ⟸ XM_039098013
- Peptide Label:	isoform X4
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953945 ⟸ XM_039098017
- Peptide Label:	isoform X7
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038953942 ⟸ XM_039098014
- Peptide Label:	isoform X4
- UniProtKB:	A6IY74 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000082587 ⟸ ENSRNOT00000101795

RefSeq Acc Id:

ENSRNOP00000096564 ⟸ ENSRNOT00000117437

Protein Domains

CTF/NF-I

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K1B6-F1-model_v2	AlphaFold	A0A0G2K1B6	1-502	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69080	AgrOrtholog
BioCyc Gene	G2FUF-6119	BioCyc
Ensembl Genes	ENSRNOG00000002983	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000034591	ENTREZGENE
	ENSRNOP00000034591.4	UniProtKB/TrEMBL
	ENSRNOP00000071775	ENTREZGENE
	ENSRNOP00000071775.2	UniProtKB/TrEMBL
	ENSRNOP00000082587.1	UniProtKB/TrEMBL
	ENSRNOP00000096564	ENTREZGENE
	ENSRNOP00000096564.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000039354	ENTREZGENE
	ENSRNOT00000039354.5	UniProtKB/TrEMBL
	ENSRNOT00000091994	ENTREZGENE
	ENSRNOT00000091994.2	UniProtKB/TrEMBL
	ENSRNOT00000101795.1	UniProtKB/TrEMBL
	ENSRNOT00000117437	ENTREZGENE
	ENSRNOT00000117437.1	UniProtKB/TrEMBL
InterPro	CTF/NFI	UniProtKB/TrEMBL
	CTF/NFI_DNA-bd-dom	UniProtKB/TrEMBL
	CTF/NFI_DNA-bd_CS	UniProtKB/TrEMBL
	CTF/NFI_DNA-bd_N	UniProtKB/TrEMBL
	MAD_homology1_Dwarfin-type	UniProtKB/TrEMBL
KEGG Report	rno:81524	UniProtKB/TrEMBL
NCBI Gene	81524	ENTREZGENE
PANTHER	CTF_NFI	UniProtKB/TrEMBL
	NUCLEAR FACTOR 1 X-TYPE	UniProtKB/TrEMBL
Pfam	CTF_NFI	UniProtKB/TrEMBL
	MH1	UniProtKB/TrEMBL
	NfI_DNAbd_pre-N	UniProtKB/TrEMBL
PhenoGen	Nfix	PhenoGen
PROSITE	CTF_NFI_1	UniProtKB/TrEMBL
	CTF_NFI_2	UniProtKB/TrEMBL
SMART	DWA	UniProtKB/TrEMBL
UniProt	A0A0G2K1B6_RAT	UniProtKB/TrEMBL
	A0A8I6AV91_RAT	UniProtKB/TrEMBL
	A0A8I6G7L6_RAT	UniProtKB/TrEMBL
	A6IY74	ENTREZGENE, UniProtKB/TrEMBL
	A6IY75_RAT	UniProtKB/TrEMBL
	A6IY76_RAT	UniProtKB/TrEMBL
	F2Z3R4	ENTREZGENE, UniProtKB/TrEMBL
	O70189	ENTREZGENE, UniProtKB/TrEMBL
	O70190	ENTREZGENE, UniProtKB/TrEMBL
	Q9QY86_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-08	Nfix	nuclear factor I X	Nf1x	nuclear factor 1 X	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-14	Nf1x	nuclear factor 1 X	Nfix	nuclear factor I/X (CCAAT-binding transcription factor)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Nfix	nuclear factor I/X (CCAAT-binding transcription factor)	Nfix	nuclear factor I/X	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Nfix	nuclear factor I/X			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the olfactory nasal mucosa	633408

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM