Fdps (farnesyl diphosphate synthase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fdps (farnesyl diphosphate synthase) Rattus norvegicus

Analyze

Symbol:

Fdps

Name:

farnesyl diphosphate synthase

RGD ID:

68953

Description:

Enables geranyltranstransferase activity. Involved in several processes, including farnesyl diphosphate biosynthetic process; positive regulation of cell growth involved in cardiac muscle cell development; and positive regulation of cholesterol biosynthetic process. Located in mitochondrial matrix and peroxisome. Human ortholog(s) of this gene implicated in porokeratosis. Orthologous to human FDPS (farnesyl diphosphate synthase); PARTICIPATES IN alendronate pharmacodynamics pathway; cholesterol biosynthetic pathway; cholesterol ester storage disease pathway; INTERACTS WITH 1-(3-(trifluoromethyl)phenyl)piperazine; 1-benzylpiperazine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

(2E,6E)-farnesyl diphosphate synthase; Ac2-125; cholesterol-regulated 39 kDa protein; CR 39; dimethylallyltranstransferase; farensyl diphosphate synthase; farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase); farnesyl diphosphate synthetase; farnesyl pyrophosphate synthase; farnesyl pyrophosphate synthetase; Farnesyldiphosphate synthase; FPP synthase; FPP synthetase; FPS; geranyltranstransferase; testis-specific farnesyl pyrophosphate synthetase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FDPS (farnesyl diphosphate synthase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Fdps (farnesyl diphosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fdps (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FDPS (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FDPS (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fdps (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FDPS (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FDPS (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fdps (farnesyl diphosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RUSC1 (RUN and SH3 domain containing 1)	HGNC	Ensembl
Homo sapiens (human):	SMIM31 (small integral membrane protein 31)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FDPS (farnesyl diphosphate synthase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fdps (farnesyl diphosphate synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fdps (farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ERG20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fpps	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fdps-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	174,497,402 - 174,507,031 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	174,486,665 - 174,507,776 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	181,643,561 - 181,653,177 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,665,921 - 179,675,537 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	174,265,880 - 174,275,498 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	188,403,595 - 188,413,219 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	188,392,858 - 188,413,219 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	207,816,332 - 207,826,348 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	181,138,474 - 181,177,903 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	181,119,007 - 181,128,009 (-)	NCBI
Celera	2	168,441,483 - 168,451,110 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease type 2 (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

immunodeficiency 42 (ISO)

MHC class II deficiency (ISO)

parathyroid carcinoma (ISO)

Porokeratosis 9, Multiple Types (ISO)

Postmenopausal Osteoporosis (ISO)

severe congenital neutropenia 3 (ISO)

severe congenital neutropenia 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-(3-(trifluoromethyl)phenyl)piperazine (EXP)

1-benzylpiperazine (EXP)

1-naphthyl isothiocyanate (EXP,ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-diaminotoluene (ISO)

2,4-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

3,3',5-triiodo-L-thyronine (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

acrylamide (ISO)

Actein (EXP)

aflatoxin B1 (ISO)

alachlor (EXP)

alendronic acid (ISO)

amiodarone (EXP)

amitrole (EXP)

ammonium chloride (EXP)

antimony(0) (ISO)

Archazolid B (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

avobenzone (ISO)

Azaspiracid (ISO)

azoxystrobin (ISO)

benzatropine (ISO)

benzbromarone (EXP)

benzene (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bromobenzene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

capsaicin (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroethene (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

clozapine (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

CU-O LINKAGE (ISO)

Cuprizon (ISO)

curcumin (EXP,ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

decabromodiphenyl ether (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

Di-n-hexyl phthalate (EXP)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dichloromethane (ISO)

Dicyclohexyl phthalate (EXP)

diethylstilbestrol (EXP,ISO)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

dimethylarsinic acid (ISO)

dinophysistoxin 1 (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diuron (EXP)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (EXP,ISO)

ethyl methanesulfonate (ISO)

fluoranthene (ISO)

flusilazole (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

Ganoderic acid A (ISO)

glafenine (EXP)

hexaconazole (ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

iodide salt (EXP)

isopentenyl diphosphate (ISO)

isotretinoin (ISO)

ivermectin (ISO)

ketoconazole (EXP)

L-ethionine (EXP)

lead nitrate (EXP)

loperamide (ISO)

lovastatin (ISO)

manganese(II) chloride (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

methyltestosterone (ISO)

miconazole (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (ISO)

N-nitrosomorpholine (EXP)

nickel dichloride (ISO)

nitrofen (EXP)

obeticholic acid (ISO)

okadaic acid (ISO)

oleic acid (ISO)

omeprazole (EXP)

ozone (EXP,ISO)

paclitaxel (ISO)

pamidronate (EXP,ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP,ISO)

phenylpropanolamine (ISO)

picoxystrobin (ISO)

pinosylvin (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

quercetin (ISO)

quercetin 3-O-beta-D-glucofuranoside (ISO)

quercetin 3-O-beta-D-glucopyranoside (ISO)

quinolin-8-ol (ISO)

resveratrol (ISO)

Risedronate sodium (ISO)

silicon dioxide (ISO)

simvastatin (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sulindac sulfide (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

tetrachloromethane (EXP)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

trans-pinosylvin (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

Triptolide (ISO)

triptonide (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

zoledronic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to fatty acid (IEP)

cholesterol biosynthetic process (TAS)

farnesyl diphosphate biosynthetic process (IBA,IDA,IEA)

geranyl diphosphate biosynthetic process (IEA)

isoprenoid biosynthetic process (IEA)

male gonad development (IEP)

positive regulation of cell growth involved in cardiac muscle cell development (IMP)

positive regulation of cholesterol biosynthetic process (IMP)

response to cholesterol (IEP)

response to peptide hormone (IEP)

response to testosterone (IEP)

response to xenobiotic stimulus (IEP)

spermatogenesis (IEP)

Cellular Component

cytoplasm (IBA)

cytosol (ISO)

mitochondrial matrix (IDA)

nucleoplasm (ISO)

peroxisome (IDA)

Molecular Function

dimethylallyltranstransferase activity (IBA)

geranyltranstransferase activity (IBA,IDA,TAS)

metal ion binding (IEA)

protein binding (ISO)

transferase activity (IEA)

transferase activity, transferring alkyl or aryl (other than methyl) groups (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

alendronate pharmacodynamics pathway (ISO)

cholesterol biosynthetic pathway (ISO)

cholesterol ester storage disease pathway (ISO)

congenital hemidysplasia with ichthyosiform erythroderma and limb defects pathway (ISO)

desmosterolosis pathway (ISO)

hypercholesterolemia pathway (ISO)

ibandronate pharmacodynamics pathway (ISO)

influenza A pathway (IEA)

mevalonic aciduria pathway (ISO)

nitrogenous bisphosphonate pharmacodynamics pathway (ISO)

pamidronate pharmacodynamics pathway (ISO)

risedronate pharmacodynamics pathway (ISO)

Smith-Lemli-Opitz Syndrome pathway (ISO)

statin pharmacodynamics pathway (ISO)

terpenoid biosynthetic pathway (IEA)

Wolman disease pathway (ISO)

X-linked dominant chondrodysplasia punctata 2 pathway (ISO)

zoledronate pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification and regulation of a rat liver cDNA encoding farnesyl pyrophosphate synthetase.	Ashby MN and Edwards PA, J Biol Chem. 1989 Jan 5;264(1):635-40.
2.	Alendronate lowers cholesterol synthesis in the central nervous system of rats - a preliminary study.	CIBICKOVA L, etal., Physiol Res. 2009;58(3):455-8. Epub 2008 Jul 18.
3.	Molecular cloning and sequence of a cholesterol-repressible enzyme related to prenyltransferase in the isoprene biosynthetic pathway.	Clarke CF, etal., Mol Cell Biol 1987 Sep;7(9):3138-46.
4.	An integrated genetic linkage map with 1,137 markers constructed from five F2 crosses of autoimmune disease-prone and -resistant inbred rat strains.	Dracheva SV, etal., Genomics 2000 Jan 15;63(2):202-26.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Differential binding of proteins to peroxisomes in rat hepatoma cells: unique association of enzymes involved in isoprenoid metabolism.	Gupta SD, etal., J Lipid Res. 1999 Sep;40(9):1572-84.
8.	Androgens stimulate coordinated lipogenic gene expression in normal target tissues in vivo.	Heemers H, etal., Mol Cell Endocrinol. 2003 Jul 31;205(1-2):21-31.
9.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
10.	Localization of the pre-squalene segment of the isoprenoid biosynthetic pathway in mammalian peroxisomes.	Kovacs WJ, etal., Histochem Cell Biol. 2007 Mar;127(3):273-90. Epub 2006 Dec 19.
11.	Farnesyl-diphosphate synthase is localized in peroxisomes.	Krisans SK, etal., J Biol Chem. 1994 May 13;269(19):14165-9.
12.	Hepatic farnesyl diphosphate synthase expression is suppressed by polyunsaturated fatty acids.	Le Jossic-Corcos C, etal., Biochem J. 2005 Feb 1;385(Pt 3):787-94.
13.	Peroxisome proliferator-activated receptor alpha (PPARalpha) activators induce hepatic farnesyl diphosphate synthase gene expression in rodents.	Le Jossic-Corcos C, etal., J Steroid Biochem Mol Biol. 2004 Feb;88(2):203-11.
14.	Pituitary regulation of the expression of the farnesyl pyrophosphate synthetase gene in the testes of the sexually maturing rat.	Nazian SJ, etal., J Androl. 1991 Jul-Aug;12(4):264-72.
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
19.	An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.	Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
20.	GOA pipeline	RGD automated data pipeline
21.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
23.	Isoprenoid biosynthesis in rat liver mitochondria. Studies on farnesyl pyrophosphate synthase and trans-prenyltransferase.	Runquist M, etal., J Biol Chem. 1994 Feb 25;269(8):5804-9.
24.	Molecular cloning and promoter analysis of the rat liver farnesyl diphosphate synthase gene.	Spear DH, etal., J Biol Chem 1992 Jul 15;267(20):14462-9.
25.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
26.	Testis-specific transcripts of rat farnesyl pyrophosphate synthetase are developmentally regulated and localized to haploid germ cells.	Teruya JH, etal., Biol Reprod. 1991 Apr;44(4):663-71.
27.	Testis-specific transcription initiation sites of rat farnesyl pyrophosphate synthetase mRNA.	Teruya JH, etal., Mol Cell Biol 1990 May;10(5):2315-26.
28.	Defects of cholesterol biosynthesis.	Waterham HR FEBS Lett. 2006 Oct 9;580(23):5442-9. Epub 2006 Jul 20.
29.	Inhibition of farnesylpyrophosphate synthase prevents angiotensin II-induced hypertrophic responses in rat neonatal cardiomyocytes: involvement of the RhoA/Rho kinase pathway.	Ye Y, etal., FEBS Lett. 2009 Sep 17;583(18):2997-3003. Epub 2009 Aug 28.

Additional References at PubMed

PMID:18614015	PMID:19800872	PMID:22658674	PMID:24527834	PMID:24625528	PMID:25847782

Genomics

Comparative Map Data

Fdps
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	174,497,402 - 174,507,031 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	174,486,665 - 174,507,776 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	181,643,561 - 181,653,177 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,665,921 - 179,675,537 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	174,265,880 - 174,275,498 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	188,403,595 - 188,413,219 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	188,392,858 - 188,413,219 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	207,816,332 - 207,826,348 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	181,138,474 - 181,177,903 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	181,119,007 - 181,128,009 (-)	NCBI
Celera	2	168,441,483 - 168,451,110 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

FDPS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	155,308,866 - 155,320,665 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	155,308,748 - 155,320,666 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	155,278,657 - 155,290,456 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	153,545,374 - 153,557,080 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	152,092,649 - 152,103,529	NCBI
Celera	1	128,351,680 - 128,363,599 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI
HuRef	1	126,640,838 - 126,652,759 (+)	NCBI		HuRef
CHM1_1	1	156,673,976 - 156,685,898 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	154,447,406 - 154,459,205 (+)	NCBI		T2T-CHM13v2.0

Fdps
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	89,000,895 - 89,009,274 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	89,000,895 - 89,009,266 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	89,093,588 - 89,101,967 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	89,093,588 - 89,101,959 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	88,897,510 - 88,905,867 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	89,179,515 - 89,187,872 (-)	NCBI		MGSCv36	mm8
Celera	3	89,132,279 - 89,140,636 (-)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	39.01	NCBI

Fdps
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	1,757,418 - 1,765,028 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955545	1,757,090 - 1,765,028 (+)	NCBI	ChiLan1.0	ChiLan1.0

FDPS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	94,255,158 - 94,267,161 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	130,653,316 - 130,665,196 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	134,258,881 - 134,270,237 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	134,258,968 - 134,270,237 (+)	Ensembl	panpan1.1		panPan2

FDPS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	42,241,086 - 42,250,373 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	42,241,107 - 42,250,225 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	41,731,911 - 41,741,200 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	42,110,187 - 42,119,478 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	42,110,191 - 42,119,346 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	41,890,063 - 41,899,349 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	41,943,839 - 41,953,128 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	42,227,832 - 42,237,121 (-)	NCBI		UU_Cfam_GSD_1.0

Fdps
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	25,768,903 - 25,778,024 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936580	4,799,354 - 4,808,406 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FDPS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	94,500,141 - 94,518,408 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	94,500,140 - 94,514,820 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	103,291,797 - 103,304,940 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FDPS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	8,514,311 - 8,526,363 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	7,851,669 - 7,864,161 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fdps
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	943,571 - 949,528 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624885	942,998 - 949,529 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fdps
32 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	176
Count of miRNA genes:	142
Interacting mature miRNAs:	153
Transcripts:	ENSRNOT00000033917, ENSRNOT00000065065
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	175950118	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	172982062	175950118	Rat

Markers in Region

D2Arb36

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,507,381 - 174,507,593 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,413,570 - 188,413,781	NCBI	Rnor6.0
Rnor_5.0	2	207,826,699 - 207,826,910	UniSTS	Rnor5.0
RGSC_v3.4	2	181,178,253 - 181,178,466	RGD	RGSC3.4
RGSC_v3.4	2	181,178,254 - 181,178,466	UniSTS	RGSC3.4
RGSC_v3.1	2	181,128,359 - 181,128,572	RGD
Celera	2	168,451,461 - 168,451,672	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH127967

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	2	q34	UniSTS

AA408288

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,487,951 - 174,488,122 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,394,145 - 188,394,315	NCBI	Rnor6.0
Rnor_5.0	2	207,806,504 - 207,806,674	UniSTS	Rnor5.0
RGSC_v3.4	2	181,157,880 - 181,158,050	UniSTS	RGSC3.4
Celera	2	168,432,196 - 168,432,366	UniSTS
Cytogenetic Map	2	q34	UniSTS

AW534365

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,488,335 - 174,488,454 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,394,529 - 188,394,647	NCBI	Rnor6.0
Rnor_5.0	2	207,806,888 - 207,807,006	UniSTS	Rnor5.0
RGSC_v3.4	2	181,158,264 - 181,158,382	UniSTS	RGSC3.4
Celera	2	168,432,580 - 168,432,698	UniSTS
RH 3.4 Map	2	1160.7	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH128237

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,488,052 - 174,488,233 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,394,246 - 188,394,426	NCBI	Rnor6.0
Rnor_5.0	2	207,806,605 - 207,806,785	UniSTS	Rnor5.0
RGSC_v3.4	2	181,157,981 - 181,158,161	UniSTS	RGSC3.4
Celera	2	168,432,297 - 168,432,477	UniSTS
RH 3.4 Map	2	1156.2	UniSTS
Cytogenetic Map	2	q34	UniSTS

BQ193911

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,486,692 - 174,486,851 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,392,886 - 188,393,044	NCBI	Rnor6.0
Rnor_5.0	2	207,805,245 - 207,805,403	UniSTS	Rnor5.0
RGSC_v3.4	2	181,156,621 - 181,156,779	UniSTS	RGSC3.4
Celera	2	168,430,937 - 168,431,095	UniSTS
RH 3.4 Map	2	1162.0	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	41	57	41	19	41	8	11	74	35	41	11	8
Low		2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M17300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M34477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M89945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000033917 ⟹ ENSRNOP00000031191

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,486,665 - 174,506,182 (-)	Ensembl
Rnor_6.0 Ensembl	2	188,392,858 - 188,412,329 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000065065 ⟹ ENSRNOP00000058918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,497,399 - 174,506,141 (-)	Ensembl
Rnor_6.0 Ensembl	2	188,403,595 - 188,413,219 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000080185 ⟹ ENSRNOP00000070394

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,497,405 - 174,506,923 (-)	Ensembl
Rnor_6.0 Ensembl	2	188,403,583 - 188,412,362 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094500 ⟹ ENSRNOP00000083196

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,487,922 - 174,493,757 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103438 ⟹ ENSRNOP00000096239

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,487,922 - 174,507,776 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000118716 ⟹ ENSRNOP00000076679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,487,922 - 174,507,362 (-)	Ensembl

RefSeq Acc Id:

NM_031840 ⟹ NP_114028

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	174,497,402 - 174,507,031 (-)	NCBI
Rnor_6.0	2	188,403,595 - 188,413,219 (-)	NCBI
Rnor_5.0	2	207,816,332 - 207,826,348 (-)	NCBI
RGSC_v3.4	2	181,138,474 - 181,177,903 (-)	RGD
Celera	2	168,441,483 - 168,451,110 (-)	RGD

Sequence:

show sequence

TTATATTTGGGTTCTGCCTACTGAGCCGGGAGTCTGGGAACTACAACTCCCAGAGTGCTGAGCG
GATGCACGCTCTGCTTTTAGGTGTAAGCCGCAAACATCTTGGACCCCGGGAGAATCCGCGTTGA
AGCACAGAGCATTTAGCTCCTCTGTCAGAATGAATGGGGACCAGAAACTGGATGTTCATAACCA
AGAAAAGCAGAATTTCATCCAGCACTTCTCCCAGATTGTCAAGGTGCTGACTGAGGATGAACTG
GGACACCCAGAGAAGGGAGATGCTATTACCCGGATCAAAGAGGTCCTGGAGTACAACACTGTAG
GAGGCAAGTACAATCGGGGTCTGACGGTGGTACAGACCTTCCAGGAACTGGTGGAACCAAGGAA
ACAGGATGCTGAGAGCCTACAGCGGGCCCTGACGGTGGGCTGGTGTGTAGAACTGCTCCAGGCT
TTCTTCCTCGTGTTAGATGACATCATGGACTCTTCCCACACTCGCCGGGGGCAGATCTGCTGGT
ATCAGAAGCCGGGCATAGGCTTGGATGCCATCAACGATGCTCTGCTTCTGGAAGCCGCTATCTA
CCGCCTGCTTAAGTTCTACTGCAGGGAGCAGCCCTACTACCTCAACCTGCTGGAGCTCTTTCTA
CAGAGTTCCTATCAGACTGAGATCGGGCAGACTCTCGACCTCATCACAGCACCCCAGGGCCAAG
TGGATCTTGGTAGATACACTGAAAAGAGGTACAAATCTATCGTCAAGTACAAGACAGCTTTCTA
CTCTTTCTACCTGCCTATCGCGGCTGCCATGTACATGGCTGGAATTGATGGGGAGAAGGAACAC
GCTAATGCCCTGAAGATCCTGCTGGAGATGGGCGAGTTCTTCCAGATCCAGGACGACTACCTTG
ATCTCTTTGGAGACCCCAGTGTGACCGGAAAGGTCGGCACTGACATCCAGGACAACAAATGCAG
CTGGCTGGTGGTTCAGTGTCTGCTACGAGCCACTCCTCAGCAGCGCCAGATCTTAGAGGAGAAT
TATGGGCAGAAGGACCCAGAAAAAGTGGCGCGGGTGAAAGCACTGTACGAGGAGCTGGATCTGC
GGAGTGTGTTCTTCAAGTACGAGGAAGACAGTTACAACCGCCTCAAGAGTCTCATAGAGCAGTG
CTCCGCGCCCCTGCCCCCATCCATCTTCCTGGAACTAGCAAACAAGATCTACAAGCGGAGAAAG
TAACCTCGAATTGTAGAGGCTGCGAGGGAGGGGTCTCAATAAATTATTGTTCAAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_114028	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40960	(Get FASTA)	NCBI Sequence Viewer
	AAA41143	(Get FASTA)	NCBI Sequence Viewer
	AAH59125	(Get FASTA)	NCBI Sequence Viewer
	EDM00669	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031191.4
	ENSRNOP00000058918.3
	ENSRNOP00000070394
	ENSRNOP00000070394.1
GenBank Protein	P05369	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_114028 ⟸ NM_031840

- UniProtKB:

Q6GT82 (UniProtKB/Swiss-Prot), P05369 (UniProtKB/Swiss-Prot), A6J6C0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNGDQKLDVHNQEKQNFIQHFSQIVKVLTEDELGHPEKGDAITRIKEVLEYNTVGGKYNRGLTV
VQTFQELVEPRKQDAESLQRALTVGWCVELLQAFFLVLDDIMDSSHTRRGQICWYQKPGIGLDA
INDALLLEAAIYRLLKFYCREQPYYLNLLELFLQSSYQTEIGQTLDLITAPQGQVDLGRYTEKR
YKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANALKILLEMGEFFQIQDDYLDLFGDPSVTG
KVGTDIQDNKCSWLVVQCLLRATPQQRQILEENYGQKDPEKVARVKALYEELDLRSVFFKYEED
SYNRLKSLIEQCSAPLPPSIFLELANKIYKRRK

hide sequence

RefSeq Acc Id:

ENSRNOP00000031191 ⟸ ENSRNOT00000033917

RefSeq Acc Id:

ENSRNOP00000070394 ⟸ ENSRNOT00000080185

RefSeq Acc Id:

ENSRNOP00000058918 ⟸ ENSRNOT00000065065

RefSeq Acc Id:

ENSRNOP00000076679 ⟸ ENSRNOT00000118716

RefSeq Acc Id:

ENSRNOP00000083196 ⟸ ENSRNOT00000094500

RefSeq Acc Id:

ENSRNOP00000096239 ⟸ ENSRNOT00000103438

Protein Domains

RUN SH3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P05369-F1-model_v2	AlphaFold	P05369	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691456

Promoter ID:

EPDNEW_R1981

Type:

initiation region

Name:

Fdps_1

Description:

farnesyl diphosphate synthase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	188,413,113 - 188,413,173	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68953	AgrOrtholog
BioCyc Gene	G2FUF-52455	BioCyc
BioCyc Pathway	PWY-5122 [geranyl diphosphate biosynthesis]	BioCyc
	PWY-5123 [trans, trans-farnesyl diphosphate biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000043377	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000033917.7	UniProtKB/TrEMBL
	ENSRNOT00000065065.3	UniProtKB/TrEMBL
	ENSRNOT00000080185	ENTREZGENE
	ENSRNOT00000080185.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.600.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.58.900	UniProtKB/TrEMBL
	SH3 Domains	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6919326	IMAGE-MGC_LOAD
InterPro	FPS1-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Isoprenoid_synthase_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Polyprenyl_synt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Polyprenyl_synt_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Run	UniProtKB/TrEMBL
	Run_dom_sf	UniProtKB/TrEMBL
	RUN_RUSC1	UniProtKB/TrEMBL
	RUSC1_2	UniProtKB/TrEMBL
	SH3-like_dom	UniProtKB/TrEMBL
	SH3_domain	UniProtKB/TrEMBL
KEGG Report	rno:83791	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72758	IMAGE-MGC_LOAD
NCBI Gene	83791	ENTREZGENE
PANTHER	FARNESYL PYROPHOSPHATE SYNTHASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FARNESYL-PYROPHOSPHATE SYNTHETASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RUN AND SH3 DOMAIN CONTAINING	UniProtKB/TrEMBL
	RUN AND SH3 DOMAIN-CONTAINING PROTEIN 1	UniProtKB/TrEMBL
Pfam	polyprenyl_synt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RUN	UniProtKB/TrEMBL
	SH3_9	UniProtKB/TrEMBL
PharmGKB	FDPS	RGD
PhenoGen	Fdps	PhenoGen
PROSITE	POLYPRENYL_SYNTHASE_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLYPRENYL_SYNTHASE_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RUN	UniProtKB/TrEMBL
	SH3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000043377	RatGTEx
SMART	RUN	UniProtKB/TrEMBL
	SH3	UniProtKB/TrEMBL
Superfamily-SCOP	SH3	UniProtKB/TrEMBL
	SSF140741	UniProtKB/TrEMBL
	SSF48576	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JXT3_RAT	UniProtKB/TrEMBL
	A6J6C0	ENTREZGENE, UniProtKB/TrEMBL
	F1LND7_RAT	UniProtKB/TrEMBL
	FPPS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6GT82	ENTREZGENE
	Q7TPK0_RAT	UniProtKB/TrEMBL
UniProt Secondary	F1LMQ2	UniProtKB/TrEMBL
	Q6GT82	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Fdps	farnesyl diphosphate synthase	Fdps	farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Fdps	farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase)	Fdps	farnesyl diphosphate synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Fdps	farnesyl diphosphate synthetase	Fdps	farnesyl diphosphate synthase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-09-11		farnesyl diphosphate synthase	Fdps	farensyl diphosphate synthase	Name updated	1299863	APPROVED
2002-06-10	Fdps	farensyl diphosphate synthase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	catalyzes the formation of geranyl- and farnesylpyrophosphate from the condensation of isopentenyl pyrophosphate with dimethylallyl pyrophosphate
gene_pathway	part of isoprene biosynthetic pathway, which provides the cell with cholesterol, ubiquinone, dolichol, and other nonsterol metabolites	61515
gene_process	functions in the isoprene biosynthetic pathway
gene_regulation	co-regulated with HMG-CoA synthase and HMG-CoA reductase	61515

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)