Advanced Search (OLGA)

Gene: Stmn2 (stathmin 2) Rattus norvegicus

Analyze

Symbol:

Stmn2

Name:

stathmin 2

RGD ID:

68947

Description:

Predicted to enable calcium-dependent protein binding activity and tubulin binding activity. Predicted to be involved in several processes, including cellular response to nerve growth factor stimulus; regulation of microtubule polymerization or depolymerization; and regulation of neuron projection development. Located in growth cone and vesicle. Orthologous to human STMN2 (stathmin 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC105372; SCG10; Scgn10; stathmin-2; stathmin-like 2; superior cervical ganglion-10 protein; superiorcervical ganglia neural specific 10; superiorcervical ganglia, neural specific 10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	STMN2 (stathmin 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Stmn2 (stathmin-like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Stmn2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Stmn2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	STMN2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Stmn2 (stathmin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	STMN2 (stathmin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Stmn2 (stathmin-like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stmn2b (stathmin 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stmn2a (stathmin 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	stai	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	stai	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	stmn2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	stmn2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	95,112,017 - 95,159,642 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	95,112,019 - 95,159,335 (-)	Ensembl				GRCr8
mRatBN7.2	2	93,204,690 - 93,252,011 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	93,204,692 - 93,252,011 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	99,728,967 - 99,776,344 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	97,849,998 - 97,897,381 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	92,906,867 - 92,954,252 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	95,424,251 - 95,471,900 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	95,424,251 - 95,472,115 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	115,167,504 - 115,215,213 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	95,284,903 - 95,332,686 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	88,774,309 - 88,821,687 (-)	NCBI		Celera
RGSC_v3.1	2	95,229,866 - 95,277,648 (-)	NCBI
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amyotrophic lateral sclerosis (ISS)

motor peripheral neuropathy (ISS)

neuropathy (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,4-dihydroxybenzoic acid (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arotinoid acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

Butylparaben (EXP)

C60 fullerene (EXP)

cadmium dichloride (EXP)

carbon nanotube (ISO)

CHIR 99021 (ISO)

chlorpyrifos (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

cortisol (ISO)

crocidolite asbestos (ISO)

DDE (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dimethylarsinic acid (EXP)

doramapimod (EXP)

dorsomorphin (ISO)

enzacamene (EXP)

epoxiconazole (EXP)

ethanol (ISO)

etoposide (ISO)

ferric oxide (EXP)

furan (EXP)

indometacin (ISO)

ivermectin (ISO)

ketoconazole (EXP)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

linuron (EXP)

methylazoxymethanol (ISO)

methylmercury chloride (ISO)

mifepristone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-N-nitrosourea (ISO)

nickel atom (ISO)

nitrofen (EXP)

ozone (ISO)

panobinostat (ISO)

paraquat (EXP)

pirinixic acid (ISO)

prochloraz (EXP)

procymidone (EXP)

progesterone (ISO)

rotenone (ISO)

sarin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

thalidomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

uranium atom (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to nerve growth factor stimulus (IEA,ISO,ISS)

microtubule depolymerization (IBA)

negative regulation of microtubule depolymerization (IEA,ISO)

negative regulation of microtubule polymerization (IEA,ISO,ISS)

negative regulation of neuron projection development (IEA,ISO)

neuron projection development (IBA)

positive regulation of microtubule depolymerization (IEA,ISO)

positive regulation of neuron projection development (IEA,ISO,ISS)

regulation of microtubule polymerization or depolymerization (IBA,IEA)

Cellular Component

axon (IEA)

cell projection (IEA)

cytoplasm (IBA,IEA,ISO,ISS)

endosome (IEA)

Golgi apparatus (IEA)

growth cone (IBA,IDA,IEA,ISO)

lamellipodium (IEA,ISO,ISS)

membrane (IEA)

neuron projection (IBA,IEA,ISO,ISS)

neuronal cell body (IEA,ISO,ISS)

perinuclear region of cytoplasm (IEA,ISO)

vesicle (IDA)

Molecular Function

calcium-dependent protein binding (IEA,ISO)

protein binding (IPI,ISO)

tubulin binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The stathmin phosphoprotein family: intracellular localization and effects on the microtubule network.	Gavet O, etal., J Cell Sci 1998 Nov;111 ( Pt 22):3333-46.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	TRPC5 is a regulator of hippocampal neurite length and growth cone morphology.	Greka A, etal., Nat Neurosci 2003 Aug;6(8):837-45.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	The interaction of RGSZ1 with SCG10 attenuates the ability of SCG10 to promote microtubule disassembly.	Nixon AB, etal., J Biol Chem 2002 May 17;277(20):18127-33. Epub 2002 Mar 6.
8.	Differential, regional, and cellular expression of the stathmin family transcripts in the adult rat brain.	Ozon S, etal., J Neurosci Res 1999 Jun 1;56(5):553-64.
9.	Identification of upregulated SCG10 mRNA expression associated with late-phase long-term potentiation in the rat hippocampal Schaffer-CA1 pathway in vivo.	Peng H, etal., J Neurosci 2003 Jul 23;23(16):6617-26.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	JNK1 phosphorylation of SCG10 determines microtubule dynamics and axodendritic length.	Tararuk T, etal., J Cell Biol. 2006 Apr 24;173(2):265-77. Epub 2006 Apr 17.
14.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:3272176	PMID:12477932	PMID:14741408	PMID:15200951	PMID:15489334	PMID:15581637	PMID:16838365	PMID:18422486	PMID:18452648	PMID:18996843	PMID:19959466	PMID:20106964
PMID:20621975	PMID:20802173	PMID:21215777	PMID:21471001

Genomics

Comparative Map Data

Stmn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	95,112,017 - 95,159,642 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	95,112,019 - 95,159,335 (-)	Ensembl				GRCr8
mRatBN7.2	2	93,204,690 - 93,252,011 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	93,204,692 - 93,252,011 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	99,728,967 - 99,776,344 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	97,849,998 - 97,897,381 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	92,906,867 - 92,954,252 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	95,424,251 - 95,471,900 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	95,424,251 - 95,472,115 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	115,167,504 - 115,215,213 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	95,284,903 - 95,332,686 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	88,774,309 - 88,821,687 (-)	NCBI		Celera
RGSC_v3.1	2	95,229,866 - 95,277,648 (-)	NCBI
Cytogenetic Map	2	q23	NCBI

STMN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	79,611,117 - 79,666,158 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	79,611,117 - 79,666,158 (+)	Ensembl			hg38	GRCh38
GRCh37	8	80,523,352 - 80,578,393 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	80,685,935 - 80,739,792 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	80,685,934 - 80,739,779	NCBI
Celera	8	76,527,590 - 76,581,458 (+)	NCBI		Celera
Cytogenetic Map	8	q21.13	NCBI
HuRef	8	76,012,743 - 76,068,118 (+)	NCBI		HuRef
CHM1_1	8	80,575,276 - 80,630,679 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	80,042,462 - 80,097,513 (+)	NCBI		T2T-CHM13v2.0

Stmn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	8,574,587 - 8,626,664 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	8,574,420 - 8,626,666 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	8,509,527 - 8,561,604 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	8,509,360 - 8,561,606 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	8,509,527 - 8,561,604 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	8,492,600 - 8,544,677 (+)	NCBI		MGSCv36	mm8
Celera	3	8,514,599 - 8,566,747 (+)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI
cM Map	3	2.15	NCBI

Stmn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955444	1,584,560 - 1,646,812 (-)	Ensembl
ChiLan1.0	NW_004955444	1,585,042 - 1,646,812 (-)	NCBI	ChiLan1.0	ChiLan1.0

STMN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	95,350,636 - 95,406,105 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	70,980,769 - 71,036,051 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	76,137,827 - 76,193,112 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	77,768,471 - 77,823,909 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	77,765,243 - 77,827,611 (+)	Ensembl			panPan2	panpan1.1

STMN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	27,055,891 - 27,105,695 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	27,055,900 - 27,104,501 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	27,329,341 - 27,379,157 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	27,179,142 - 27,228,977 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	27,179,152 - 27,228,973 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	27,224,785 - 27,274,552 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	27,263,476 - 27,313,267 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	27,620,016 - 27,669,831 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Stmn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	51,992,013 - 52,044,650 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936871	519,611 - 572,460 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936871	519,611 - 572,429 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STMN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	56,952,978 - 57,006,462 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	56,952,968 - 57,006,744 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	62,173,165 - 62,226,945 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STMN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	75,071,514 - 75,127,605 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	75,071,638 - 75,128,187 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	66,074,674 - 66,130,665 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stmn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	11,572,745 - 11,630,819 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624744	11,573,707 - 11,630,570 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Stmn2
363 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	333
Count of miRNA genes:	205
Interacting mature miRNAs:	243
Transcripts:	ENSRNOT00000015720
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	78269809	104744824	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
2317886	Alcrsp23	Alcohol response QTL 23	2.4	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	95142371	140142371	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Markers in Region

D8S1385E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	93,204,790 - 93,204,900 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	95,424,352 - 95,424,461	NCBI	Rnor6.0
Rnor_5.0	2	115,167,605 - 115,167,714	UniSTS	Rnor5.0
RGSC_v3.4	2	95,285,004 - 95,285,113	UniSTS	RGSC3.4
Celera	2	88,774,410 - 88,774,519	UniSTS
Cytogenetic Map	2	q23	UniSTS

AI454126

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	93,204,851 - 93,205,039 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	95,424,413 - 95,424,600	NCBI	Rnor6.0
Rnor_5.0	2	115,167,666 - 115,167,853	UniSTS	Rnor5.0
RGSC_v3.4	2	95,285,065 - 95,285,252	UniSTS	RGSC3.4
Celera	2	88,774,471 - 88,774,658	UniSTS
RH 3.4 Map	2	589.3	UniSTS
Cytogenetic Map	2	q23	UniSTS

D8S1388E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	95,112,047 - 95,112,136 (+)	Marker Load Pipeline
mRatBN7.2	2	93,204,719 - 93,204,809 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	95,424,281 - 95,424,370	NCBI	Rnor6.0
Rnor_5.0	2	115,167,534 - 115,167,623	UniSTS	Rnor5.0
RGSC_v3.4	2	95,284,933 - 95,285,022	UniSTS	RGSC3.4
Celera	2	88,774,339 - 88,774,428	UniSTS
Cytogenetic Map	2	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	11	56	159	84	83	52	34	52	6	241	122	10	138	48	73	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF306458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015720 ⟹ ENSRNOP00000015720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	95,112,019 - 95,159,335 (-)	Ensembl
mRatBN7.2 Ensembl	2	93,204,692 - 93,252,011 (-)	Ensembl
Rnor_6.0 Ensembl	2	95,424,251 - 95,472,115 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095634 ⟹ ENSRNOP00000083052

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	95,112,019 - 95,131,167 (-)	Ensembl
mRatBN7.2 Ensembl	2	93,204,692 - 93,223,840 (-)	Ensembl

RefSeq Acc Id:

NM_053440 ⟹ NP_445892

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	95,112,017 - 95,159,335 (-)	NCBI
mRatBN7.2	2	93,204,690 - 93,252,011 (-)	NCBI
Rnor_6.0	2	95,424,251 - 95,471,900 (-)	NCBI
Rnor_5.0	2	115,167,504 - 115,215,213 (-)	NCBI
RGSC_v3.4	2	95,284,903 - 95,332,686 (-)	RGD
Celera	2	88,774,309 - 88,821,687 (-)	RGD

Sequence:

show sequence

CCGCTCCGAGCGTGCACATCCCTACAATGGCTAAAACAGCAATGGCCTACAAGGAAAAAATGAA
GGAGCTGTCTATGCTGTCACTGATCTGCTCCTGCTTCTACCCGGAGCCTCGCAACATCAACATC
TACACCTACGATGACATGGAGGTGAAGCAGATCAACAAGCGTGCTTCCGGCCAGGCTTTCGAGC
TGATCTTAAAGCCCCCGTCTCCCATCTCGGAAGCTCCACGAACTCTAGCTTCTCCAAAGAAGAA
AGACCTGTCTCTGGAGGAGATCCAGAAAAAGCTGGAGGCTGCAGAGGGGCGAAGGAAGTCTCAG
GAGGCCCAGGTGCTGAAGCAGTTGGCAGAGAAGAGGGAGCACGAGCGAGAAGTCCTCCAGAAGG
CTTTGGAGGAGAATAACAACTTCAGCAAGATGGCGGAGGAGAAGCTGATCCTGAAAATGGAACA
AATTAAGGAAAACCGTGAGGCTAATCTAGCTGCTATCATTGAACGTCTGCAGGAAAAGGAGAGG
CATGCTGCCGAGGTGCGCAGGAACAAGGAACTGCAGGTTGAACTGTCTGGCTGAAGCAATGGCG
GGTATGGCACGCCCCTCCCATAGTAAATCCCCCTGCCTATATTATAATGGATCATGCGATATCA
GTATGGGAAAATGTATGACATGGTTTAAAAAGAACTCATTATGAAAAAAAAACAGAATCAAAAA
TAAAATAAATCAATGCGGTCTCTTTGCAGAATGTTTTGCTTGATGTTTAAAAAAGTACCTTGGA
TCTTATTTTGTAAATATTTACATTTTTGTTAAAAAATACAAGTATTGCATTATGCAAGTTATTT
CATAATCTTACATGTCCTGTAACAGGCATTCGATGTTGTGTCTTCCCACTCAAATGAATTTGCT
AGCTCTATTCTTTTGGAAGCTCCCCCATGTTGAACTCAGTCCCTGCCCTTTTCATTCCACCCAA
AAATGAGGTCAGTAGACAGTCTATGGTGCTAGAAACCCACCATTGCCTAGTGACCTAGATGACT
CCATACTCTCCGAGCTTGGCCAAGACCACACCTAGATCGTGGGGACCGTGTGCCCATGTGAACC
TCCACATTTCTCTGCTCATAATCTGCTTCCTGCCTAGAAACCACAAAGCCAGGCTAAGGAAATC
CACCAGTCCTAGCACTGACCTCTGCTTCTCGTGGAGTGTGTGCTTCACTCGTGTTTGGGTTTTA
GAAAGAGATGAATGGGAAGACAGAGCTGTGCTCAATGAGGGTAGAAGGGCGAGGCTGAACCTTC
TAATGGGCCGAACACAAACACAAAGCTAGAGGGTTCGAGCGGCCATGACGTTGTTCTTCATGAA
GTGGGCTTTCTTCTCTTGTTTCGGTTATTTTGATGGAATGACTTAATCAACATGTCGATGGCTT
ATCTGTGGGTGCCATGGGTGACGATGTTCGTTTTAAGCTTTTGCCTGTAGTACAAGCACATGAT
GCTACTAAATATTTTTCCACTTGGAGACTGTGAGCTGGTTGTTGCATTAAACACACAAACGAAA
TCACAAACACTGTGGACTTTTACTCAAGCTGGTCTTTCATTCCCAGTGTAGGGCAATCCTGCCT
ATAAACAAGACCAAATCACTCCATCTGTGACGCTGCCGCAGTTAAGGGGGCTAGGCAGGGCATT
TGTGCCACTGTAAGAATCAGCAGAGACCCAGCATACGTACCTTTTGCAGTTTTGAAGTTGTCTT
TCCCCAACTCCCAACTCCTGAAGGTTGCTGCCTGCATACTTACTTCTCGTCAGTGCTATCTTCT
TGTATGTCATTGTGAGCAAACTGTGATGAATAAAGAATTGGAGTTCTGTGAACTAAAAAAAAAA
AAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063282645 ⟹ XP_063138715

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	95,112,017 - 95,159,642 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_445892	(Get FASTA)	NCBI Sequence Viewer
	XP_063138715	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG33230	(Get FASTA)	NCBI Sequence Viewer
	AAH87660	(Get FASTA)	NCBI Sequence Viewer
	EDM01022	(Get FASTA)	NCBI Sequence Viewer
	EDM01023	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015720
	ENSRNOP00000015720.5
GenBank Protein	P21818	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_445892 ⟸ NM_053440
- UniProtKB:	Q9ERH2 (UniProtKB/Swiss-Prot), P21818 (UniProtKB/Swiss-Prot), A6IH74 (UniProtKB/TrEMBL), A6IH75 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPI SEAPRTLASPKKKDLSLEEIQKKLEAAEGRRKSQEAQVLKQLAEKREHEREVLQKALEENNNFS KMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG hide sequence

Ensembl Acc Id:

ENSRNOP00000015720 ⟸ ENSRNOT00000015720

Ensembl Acc Id:

ENSRNOP00000083052 ⟸ ENSRNOT00000095634

RefSeq Acc Id:	XP_063138715 ⟸ XM_063282645
- Peptide Label:	isoform X1

Protein Domains

SLD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21818-F1-model_v2	AlphaFold	P21818	1-179	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691243

Promoter ID:

EPDNEW_R1767

Type:

multiple initiation site

Name:

Stmn2_1

Description:

stathmin 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	95,471,943 - 95,472,003	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68947	AgrOrtholog
BioCyc Gene	G2FUF-53712	BioCyc
Ensembl Genes	ENSRNOG00000011705	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015720	ENTREZGENE
	ENSRNOT00000015720.7	UniProtKB/Swiss-Prot
Gene3D-CATH	6.10.280.30	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7313867	IMAGE-MGC_LOAD
InterPro	Stathmin_CS	UniProtKB/Swiss-Prot
	Stathmin_fam	UniProtKB/Swiss-Prot
	Stathmin_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:84510	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105372	IMAGE-MGC_LOAD
NCBI Gene	84510	ENTREZGENE
PANTHER	PTHR10104	UniProtKB/Swiss-Prot
	PTHR10104:SF18	UniProtKB/Swiss-Prot
Pfam	Stathmin	UniProtKB/Swiss-Prot
PhenoGen	Stmn2	PhenoGen
PIRSF	Stathmin	UniProtKB/Swiss-Prot
PRINTS	STATHMIN	UniProtKB/Swiss-Prot
PROSITE	STATHMIN_1	UniProtKB/Swiss-Prot
	STATHMIN_2	UniProtKB/Swiss-Prot
	STATHMIN_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011705	RatGTEx
Superfamily-SCOP	SSF101494	UniProtKB/Swiss-Prot
TIGR	TC228640
UniProt	A0A8I5ZV30_RAT	UniProtKB/TrEMBL
	A6IH74	ENTREZGENE, UniProtKB/TrEMBL
	A6IH75	ENTREZGENE, UniProtKB/TrEMBL
	P21818	ENTREZGENE
	Q9ERH2	ENTREZGENE
	STMN2_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9ERH2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-04-11	Stmn2	stathmin 2	Stmn2	stathmin-like 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Stmn2	stathmin-like 2	Scgn10	superiorcervical ganglia, neural specific 10	Symbol and Name updated	629477	APPROVED
2002-06-10	Scgn10	superiorcervical ganglia, neural specific 10			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	anchored to intracellular membranes, including the Golgi apparatus, by NH2-terminal domain through palmitoylation of two cysteines	61521
gene_cellular_localization	anchored to intracellular membranes, including the Golgi apparatus, by NH2-terminal domain through palmitoylation of two cysteines	61528
gene_cellular_localization	localizes to the Golgi apparatus	1299171
gene_expression	present in glutamatergic neurons, such as pyramidal cells of the hippocampus and granular cells of the cerebellum	61521
gene_expression	present in glutamatergic neurons, such as pyramidal cells of the hippocampus and granular cells of the cerebellum	61528
gene_physical_interaction	interacts in vitro with tubulin in a phosphorylation-dependent manner	61528
gene_physical_interaction	interacts with RGSZ1	1299171
gene_process	involved in the neuronal-like differentiation of PC12 cells	61521
gene_process	involved in the neuronal-like differentiation of PC12 cells	61528
gene_process	sequesters free tubulin and promotes microtubule depolymerization	61528
gene_regulation	expression controlled by a neuronal restricted silencer element (NRSE)	61521
gene_regulation	expression controlled by a neuronal restricted silencer element (NRSE)	61528
gene_regulation	interaction with RGSZ1 effectively blocked the ability to induce microtubule disassembly	1299171
gene_regulation	transcription in vivo is regulated by long-lasting synaptic activity	1299172

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - MGI