Tdo2 (tryptophan 2,3-dioxygenase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tdo2 (tryptophan 2,3-dioxygenase) Mus musculus

Analyze

Symbol:

Tdo2

Name:

tryptophan 2,3-dioxygenase

RGD ID:

68532

MGI Page

MGI

Description:

Predicted to enable several functions, including heme binding activity; oxygen binding activity; and tryptophan 2,3-dioxygenase activity. Predicted to be involved in protein homotetramerization; tryptophan catabolic process to acetyl-CoA; and tryptophan catabolic process to kynurenine. Predicted to act upstream of or within tryptophan catabolic process. Is expressed in cerebellum; liver; male reproductive gland or organ; and small intestine. Human ortholog(s) of this gene implicated in Gilles de la Tourette syndrome and familial hypertryptophanemia. Orthologous to human TDO2 (tryptophan 2,3-dioxygenase).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

AA407491; chky; T; TD; TDO; tdo variant1; tdo variant2; TO; TRPO; tryptamin 2,3-dioxygenase; tryptophan oxygenase; tryptophan pyrrolase; tryptophan-2,3-dioxygenase; tryptophanase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TDO2 (tryptophan 2,3-dioxygenase)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tdo2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tdo2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TDO2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TDO2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tdo2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TDO2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TDO2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tdo2 (tryptophan 2,3-dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tdo2 (tryptophan 2,3-dioxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TDO2 (tryptophan 2,3-dioxygenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tdo2b (tryptophan 2,3-dioxygenase b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tdo2a (tryptophan 2,3-dioxygenase a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	tdo-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	v	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tdo2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	81,865,719 - 81,883,035 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	81,864,397 - 81,883,509 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	81,958,412 - 81,975,728 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	81,957,090 - 81,976,202 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	81,762,334 - 81,779,650 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	82,044,339 - 82,061,655 (-)	NCBI		MGSCv36	mm8
Celera	3	81,983,687 - 82,001,014 (-)	NCBI		Celera
Cytogenetic Map	3	E3	NCBI
cM Map	3	35.97	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (IDA)

autistic disorder (ISO)

B-lymphoblastic leukemia/lymphoma (ISO)

Endotoxemia (IMP)

familial hypertryptophanemia (ISO)

genetic disease (ISO)

Gilles de la Tourette syndrome (ISO)

Starvation (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(5-hydroxyindol-3-yl)acetic acid (EXP)

1-methyltryptophan (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-di-tert-butyl-4-methylphenol (EXP,ISO)

3',5'-cyclic AMP (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

680C91 (EXP)

acetamide (ISO)

actinomycin D (ISO)

acyclovir (ISO)

aflatoxin B1 (EXP,ISO)

allopurinol (ISO)

amiodarone (ISO)

ammonium chloride (ISO)

andrographolide (EXP)

anthranilic acid (EXP)

atrazine (ISO)

benzo[a]pyrene (EXP,ISO)

beta-naphthoflavone (EXP)

bisphenol A (ISO)

bisphenol F (EXP)

buspirone (ISO)

buta-1,3-diene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbaryl (EXP,ISO)

CGP 52608 (ISO)

chloroprene (EXP)

chlorpyrifos (ISO)

ciguatoxin CTX1B (EXP)

cisplatin (EXP)

clofibrate (EXP)

corticosterone (ISO)

cyclophosphamide (ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

dimethoate (EXP)

dioxygen (ISO)

dopamine (ISO)

dorsomorphin (ISO)

endosulfan (ISO)

ethanol (ISO)

fenofibrate (ISO)

ferroheme b (ISO)

flutamide (ISO)

folic acid (EXP)

fumonisin B1 (EXP)

genistein (EXP)

glyphosate (EXP)

gold atom (ISO)

gold(0) (ISO)

heme b (ISO)

Heptachlor epoxide (EXP)

hexachlorobenzene (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

indometacin (ISO)

kynurenine (EXP)

L-tryptophan (EXP)

lead diacetate (ISO)

lipopolysaccharide (EXP,ISO)

medroxyprogesterone acetate (ISO)

melatonin (ISO)

metformin (ISO)

methapyrilene (ISO)

methidathion (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

nickel atom (ISO)

nitroglycerin (ISO)

O-methyleugenol (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (EXP)

pioglitazone (EXP)

pirinixic acid (EXP)

potassium dichromate (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (ISO)

propanal (ISO)

propiconazole (EXP)

pyridine (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

serotonin (ISO)

sevoflurane (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulfasalazine (ISO)

sulindac (ISO)

tauroursodeoxycholic acid (ISO)

tetrachloromethane (EXP)

thioacetamide (ISO)

tolmetin (ISO)

triclosan (ISO)

valproic acid (ISO)

XL147 (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein homotetramerization (ISO)

response to nitroglycerin (ISO)

tryptophan catabolic process (IEA)

tryptophan catabolic process to acetyl-CoA (IBA,ISO)

tryptophan catabolic process to kynurenine (ISO)

tryptophan metabolic process (ISO)

Molecular Function

amino acid binding (ISO)

dioxygenase activity (IEA)

heme binding (IBA,ISO)

identical protein binding (ISO)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxygen binding (ISO)

protein binding (ISO)

tryptophan 2,3-dioxygenase activity (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

kynurenine metabolic pathway (ISO)

tryptophan metabolic pathway (IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal amino acid level (IAGP)

abnormal circulating amino acid level (IAGP)

abnormal embryo size (IEA)

abnormal heart morphology (IEA)

abnormal lens morphology (IEA)

abnormal neuron differentiation (IAGP)

abnormal neuronal precursor proliferation (IAGP)

abnormal olfactory bulb development (IAGP)

abnormal uterus morphology (IEA)

cataract (IEA)

decreased anxiety-related response (IAGP)

edema (IEA)

enlarged heart (IEA)

hydrometra (IEA)

increased circulating methionine level (IAGP)

increased circulating threonine level (IAGP)

increased heart weight (IEA)

increased prepulse inhibition (IEA)

increased serotonin level (IAGP)

microphthalmia (IEA)

preweaning lethality, complete penetrance (IEA)

preweaning lethality, incomplete penetrance (IEA)

small lateral ventricles (IAGP)

yellow coat color (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Aryl hydrocarbon receptor control of a disease tolerance defence pathway.	Bessede A, etal., Nature. 2014 Jul 10;511(7508):184-90. doi: 10.1038/nature13323.
2.	Exon and intron variants in the human tryptophan 2,3-dioxygenase gene: potential association with Tourette syndrome, substance abuse and other disorders.	Comings DE, etal., Pharmacogenetics 1996 Aug;6(4):307-18.
3.	Comparative effects of oxygen on indoleamine 2,3-dioxygenase and tryptophan 2,3-dioxygenase of the kynurenine pathway.	Dang Y, etal., Free Radic Biol Med. 2000 Feb 15;28(4):615-24.
4.	The kynurenine pathway and neurodegenerative disease.	Maddison DC and Giorgini F, Semin Cell Dev Biol. 2015 Apr;40:134-41. doi: 10.1016/j.semcdb.2015.03.002. Epub 2015 Mar 12.
5.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
6.	MGDs mouse GO annotations	MGD data from the GO Consortium
7.	Enzymatic studies on tryptophan metabolism disorder in rats chronically exposed to carbon disulfide.	Okayama A, etal., Toxicol Appl Pharmacol. 1988 Jul;94(3):356-61.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	The metabolism of L-tryptophan by isolated rat liver cells. Quantification of the relative importance of, and the effect of nutritional status on, the individual pathways of tryptophan metabolism.	Smith SA, etal., Biochem J. 1980 Nov 15;192(2):673-86.
13.	Cyclooxygenase inhibition targets neurons to prevent early behavioural decline in Alzheimer's disease model mice.	Woodling NS, etal., Brain. 2016 Jul;139(Pt 7):2063-81. doi: 10.1093/brain/aww117. Epub 2016 May 13.
14.	TDO as a therapeutic target in brain diseases.	Yu CP, etal., Metab Brain Dis. 2016 Apr 13.

Additional References at PubMed

PMID:7679723	PMID:10205167	PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12147685	PMID:12466851	PMID:12477932	PMID:14681479	PMID:14714090
PMID:15581617	PMID:16141072	PMID:16141073	PMID:16707424	PMID:16934000	PMID:19185577	PMID:19323847	PMID:19428689	PMID:20815922	PMID:20959529	PMID:21267068	PMID:21873635
PMID:22308364	PMID:23786539	PMID:24190896	PMID:24194600	PMID:24844751	PMID:25035993	PMID:25917818	PMID:26724533	PMID:27316339	PMID:27392942	PMID:27592202	PMID:27904043
PMID:28117398	PMID:28223212	PMID:28285122	PMID:28465467	PMID:30106261	PMID:30733279	PMID:31726186	PMID:33363543	PMID:34529208	PMID:37625556

Genomics

Comparative Map Data

Tdo2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	81,865,719 - 81,883,035 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	81,864,397 - 81,883,509 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	81,958,412 - 81,975,728 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	81,957,090 - 81,976,202 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	81,762,334 - 81,779,650 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	82,044,339 - 82,061,655 (-)	NCBI		MGSCv36	mm8
Celera	3	81,983,687 - 82,001,014 (-)	NCBI		Celera
Cytogenetic Map	3	E3	NCBI
cM Map	3	35.97	NCBI

TDO2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	155,903,696 - 155,920,406 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	155,854,738 - 155,920,406 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	156,824,848 - 156,841,558 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	157,044,297 - 157,061,000 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	157,182,451 - 157,199,155	NCBI
Celera	4	154,156,425 - 154,173,133 (+)	NCBI		Celera
Cytogenetic Map	4	q32.1	NCBI
HuRef	4	152,563,673 - 152,580,472 (+)	NCBI		HuRef
CHM1_1	4	156,802,468 - 156,819,210 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	159,236,403 - 159,253,174 (+)	NCBI		T2T-CHM13v2.0

Tdo2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	167,269,581 - 167,287,511 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	167,269,579 - 167,287,511 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	174,475,769 - 174,493,750 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	172,497,005 - 172,514,990 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	167,083,123 - 167,101,045 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	180,897,059 - 180,914,919 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	180,897,011 - 180,914,940 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	200,305,349 - 200,323,296 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	173,594,020 - 173,611,833 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	173,544,125 - 173,561,939 (-)	NCBI
Celera	2	161,299,362 - 161,317,278 (-)	NCBI		Celera
RH 3.4 Map	2	1078.8	RGD
Cytogenetic Map	2	q34	NCBI

Tdo2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955471	11,229,273 - 11,245,375 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955471	11,229,795 - 11,245,255 (-)	NCBI	ChiLan1.0	ChiLan1.0

TDO2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	154,170,941 - 154,187,261 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	148,269,097 - 148,285,533 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	160,085,840 - 160,102,266 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	160,085,645 - 160,102,266 (+)	Ensembl	panpan1.1		panPan2

TDO2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	53,406,110 - 53,424,260 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	53,405,957 - 53,423,958 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	53,741,684 - 53,760,577 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	54,113,213 - 54,132,114 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	54,113,237 - 54,131,283 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	53,366,630 - 53,385,412 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	53,475,754 - 53,494,647 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	53,790,005 - 53,808,893 (+)	NCBI		UU_Cfam_GSD_1.0

Tdo2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	36,991,004 - 37,015,635 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936576	2,537,702 - 2,555,785 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936576	2,537,702 - 2,555,790 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TDO2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	44,708,746 - 44,740,962 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	44,708,722 - 44,725,954 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	46,704,213 - 46,721,456 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TDO2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	102,467,075 - 102,485,434 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	102,467,640 - 102,485,394 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	82,125,379 - 82,143,064 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tdo2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624848	2,380,670 - 2,396,314 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624848	2,380,827 - 2,395,807 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tdo2
611 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	641
Count of miRNA genes:	410
Interacting mature miRNAs:	482
Transcripts:	ENSMUST00000029645, ENSMUST00000137974, ENSMUST00000151089
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
26884436	Zlq3_m	zygomatic length QTL 3, 10 week (mouse)					3	3265060	142405761	Mouse
4142399	Aec1_m	autoimmune exocrinopathy 1 (mouse)			Not determined			7586174	102690034	Mouse
4141116	Lgaq4_m	late growth adjusted QTL 4 (mouse)			Not determined			10249221	83184946	Mouse
4141255	W10q3_m	weight 10 weeks QTL 3 (mouse)			Not determined			10249221	83184946	Mouse
4141563	Lgq3_m	late growth QTL 3 (mouse)			Not determined			10249221	83184946	Mouse
39128206	Lwq18_m	liver weight QTL 18 (mouse)					3	10249221	83184946	Mouse
1357584	Splq6_m	spleen weight QTL 6 (mouse)			Not determined		3	10249221	83184946	Mouse
1357440	Hrtpq1_m	heart weight percentage QTL 1 (mouse)			Not determined		3	10249221	83184946	Mouse
26884427	Cvht4_m	cranial vault height 4, 10 week (mouse)					3	16054164	109707316	Mouse
13207570	Tcq12_m	total cholesterol QTL 12 (mouse)					3	16504164	130163649	Mouse
26884422	Cvht7_m	cranial vault height 7, 16 week (mouse)					3	28954149	118893649	Mouse
1302056	Orgwq4_m	organ weight QTL 4 (mouse)			Not determined		3	30067588	147304689	Mouse
1301705	Sles3_m	systemic lupus erythmatosus suppressor 3 (mouse)			Not determined		3	37174862	143353183	Mouse
13208566	Bmiq5_m	body mass index QTL 5 (mouse)					3	40954435	115793649	Mouse
26884380	Skwq1_m	skull length QTL 1, 5 week (mouse)					3	43954435	101607316	Mouse
4141079	Ath23_m	atherosclerosis 23 (mouse)			Not determined			49357581	83357581	Mouse
1300895	Hdl5_m	HDL level 5 (mouse)			Not determined		3	49495005	83495118	Mouse
1301824	Susp_m	suppressor of superoxide production (mouse)			Not determined		3	49495005	83495118	Mouse
26884378	Skwq6_m	skull length QTL 6, 10 week (mouse)					3	51907421	102307316	Mouse
26884382	Bzwq1_m	bi-zygomatic width QTL 1, 5 week (mouse)					3	52207421	137205761	Mouse
1357585	Manln3_m	mandible length 3 (mouse)			Not determined		3	52625509	86625745	Mouse
1301917	Tshp4_m	tooth shape 4 (mouse)			Not determined		3	52625509	86625745	Mouse
1300593	Skull4_m	skull morphology 4 (mouse)			Not determined		3	52625509	86625745	Mouse
13464139	Nhdlq17_m	non-HDL QTL 17 (mouse)					3	52923183	86923183	Mouse
11039519	Ltpr3_m	Leishmania tropica response 3 (mouse)					3	56704102	100464137	Mouse
12880419	V125Dq4_m	vitamin D active form serum level QTL 4 (mouse)					3	58907307	92907307	Mouse
4141294	Bmd24_m	bone mineral density 24 (mouse)			Not determined		3	61740061	95740241	Mouse
1301971	Cia5_m	collagen induced arthritis QTL 5 (mouse)			Not determined		3	66046658	100046795	Mouse
25314313	Syncl1_m	synaptonemal complex length 1 (mouse)					3	67907333	128393649	Mouse
11251721	Ewc3_m	ethanol withdrawal and consumption 3 (mouse)					3	69568554	103568554	Mouse
1301791	Char4_m	P. chabaudi malaria resistance QTL 4 (mouse)			Not determined		3	69625509	100655290	Mouse
1301422	Sle11_m	systematic lupus erythematosus susceptibility 11 (mouse)			Not determined		3	70208904	104209042	Mouse
11049572	Lmr11c_m	leishmaniasis resistance 11c (mouse)					3	72139967	106140094	Mouse
1300982	Lmr11_m	leishmaniasis resistance 11 (mouse)			Not determined		3	72139967	106140094	Mouse
1300595	Tmevd2_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse)			Not determined		3	75463302	109463549	Mouse
1301392	Eae3_m	susceptibility to experimental allergic encephalomyelitis 3 (mouse)			Not determined		3	79548730	113548837	Mouse
1301947	Pcfm3_m	periosteal circumference and femur length 3 (mouse)			Not determined		3	81084652	115084797	Mouse

Markers in Region

AI194855

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	81,961,095 - 81,961,214	UniSTS	GRCm38
MGSCv37	3	81,765,017 - 81,765,136	UniSTS	GRCm37
Celera	3	81,986,373 - 81,986,492	UniSTS
Cytogenetic Map	3	E3	UniSTS
Whitehead/MRC_RH	3	792.22	UniSTS

RH124606

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	81,958,511 - 81,958,627	UniSTS	GRCm38
MGSCv37	3	81,762,433 - 81,762,549	UniSTS	GRCm37
Celera	3	81,983,786 - 81,983,902	UniSTS
Cytogenetic Map	3	E3	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB476989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB476990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC159260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK132271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY223809	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC018390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S55827	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S56366	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S56367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S56368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000029645 ⟹ ENSMUSP00000029645

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	81,864,397 - 81,883,509 (-)	Ensembl
GRCm38.p6 Ensembl	3	81,957,090 - 81,976,202 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000137974

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	81,868,340 - 81,871,342 (-)	Ensembl
GRCm38.p6 Ensembl	3	81,961,033 - 81,964,035 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000151089

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	81,866,031 - 81,871,390 (-)	Ensembl
GRCm38.p6 Ensembl	3	81,958,724 - 81,964,083 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000193879 ⟹ ENSMUSP00000141237

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	81,866,098 - 81,883,509 (-)	Ensembl
GRCm38.p6 Ensembl	3	81,958,791 - 81,976,202 (-)	Ensembl

RefSeq Acc Id:

NM_019911 ⟹ NP_064295

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	3	81,865,719 - 81,883,035 (-)	NCBI
GRCm38	3	81,958,412 - 81,975,728 (-)	ENTREZGENE
MGSCv37	3	81,762,334 - 81,779,650 (-)	RGD
Celera	3	81,983,687 - 82,001,014 (-)	RGD
cM Map	3		ENTREZGENE

Sequence:

show sequence

AGCAAACCTGTGTGGTCCTGAGACACTTCAGTACTATGAGTGGGTGCCCGTTTGCAGGAAACAG
TGTAGGATACACTTTGAAAAACGTATCTATGGAGGACAATGAAGAAGACAGAGCTCAAACTGGT
GTAAACAGAGCCAGCAAAGGAGGACTTATCTATGGCAATTACTTGCAGTTGGAAAAGATTTTGA
ATGCGCAAGAACTTCAGAGTGAAGTAAAAGGGAACAAAATCCATGACGAGCACCTATTCATCAT
AACTCATCAAGCTTATGAACTTTGGTTTAAACAAATCCTCTGGGAACTAGATTCTGTTCGTGAA
ATCTTCCAAAATGGCCATGTCAGGGATGAGAGGAACATGCTCAAGGTGATAGCTCGGATGCATC
GTGTGGTGGTCATCTTCAAGCTCCTGGTACAGCAGTTCTCGGTTCTGGAAACAATGACTGCTTT
GGACTTCAATGACTTCAGAGAATACCTGTCTCCAGCATCAGGCTTCCAGAGTCTACAGTTCCGG
CTGCTGGAAAATAAGATTGGTGTTCTTCAGAGCTTGAGAGTCCCTTACAACAGGAAACACTATC
GTGATAACTTTGGAGGAGACTACAATGAGCTGTTGCTGAAATCAGAGCAGGAGCAGACGCTGTT
GCAGCTGGTGGAGGCATGGCTGGAAAGAACACCTGGTTTAGAGCCAAATGGATTTAATTTCTGG
GGAAAGTTTGAAAAAAATATCTTGAAAGGCCTGGAAGAAGAATTTCTAAGGATTCAGGCTAAAA
CCGACTCTGAAGAAAAAGAGGAACAGATGGCAGAGTTCCGGAAGCAGAAGGAGGTGCTGCTCTG
CTTGTTTGATGAGAAGCGTCATGACTACCTTCTGAGTAAAGGTGAACGACGACTGTCATACCGT
GCACTCCAGGGAGCACTGATGATATATTTTTACAGGGAGGAGCCTCGATTCCAGGTCCCTTTCC
AGCTGCTGACCTCACTTATGGACATTGACACGCTCATGACCAAATGGAGATATAATCATGTGTG
CATGGTGCACAGAATGCTGGGCACCAAGGCTGGCACTGGGGGATCCTCAGGCTATCATTACCTG
CGTTCAACTGTGAGCGACAGGTACAAGGTTTTTGTGGATTTATTTAACCTCTCAACATATCTGG
TTCCCAGACACTGGGTACCAAAGATGAATCCGATCATTCACAAATTCCTTTACACAGCCGAGTA
CAGTGACAGCTCTTACTTCAGCAGCGATGAATCGGATTGAGTTCTTCTGAACATCAGTGAAAAC
TACAGGATTCTCAGTCGGCTTTTTATAAATTTTTATGAATACATGATTGGTGTAATCTATTTAT
ATGTGTAGTTCAGTGTTATGATGTTTTGGTCCAATCCTGGAAAAAAGTTTATGATCTTGCATAT
CATGATGGTGAGCGATTAGGAGGATTAAGCATTATGATAACTGATATAGTAAAATGTTAGCATC
ATCGTACATATGATAAATTCTTGCTACAACTCAATTTACCCTGACATTTACCTCTGTAGAACCA
TTTCATATAATTATTACCTTATTGCTTCATACTTTATAAAGCTTGTTGAGCAGTTACTTTGTAT
TATAGATACAATAAATACTACCCTTCTGTACAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_064295	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB60491	(Get FASTA)	NCBI Sequence Viewer
	AAH18390	(Get FASTA)	NCBI Sequence Viewer
	AAO67707	(Get FASTA)	NCBI Sequence Viewer
	BAH84762	(Get FASTA)	NCBI Sequence Viewer
	BAH84763	(Get FASTA)	NCBI Sequence Viewer
	EDL15438	(Get FASTA)	NCBI Sequence Viewer
	EDL15439	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000029645
	ENSMUSP00000141237.2
GenBank Protein	P48776	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_064295 ⟸ NM_019911

- UniProtKB:

P48776 (UniProtKB/Swiss-Prot), Q8VCW3 (UniProtKB/TrEMBL), C5NSA7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGN
KIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQ
FSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELL
LKSEQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAE
FRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTL
MTKWRYNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPI
IHKFLYTAEYSDSSYFSSDESD

hide sequence

RefSeq Acc Id:

ENSMUSP00000029645 ⟸ ENSMUST00000029645

RefSeq Acc Id:

ENSMUSP00000141237 ⟸ ENSMUST00000193879

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P48776-F1-model_v2	AlphaFold	P48776	1-406	view protein structure

Promoters

RGD ID:

6834535

Promoter ID:

MM_KWN:34667

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Liver

Transcripts:

OTTMUST00000055915, OTTMUST00000055916

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	3	81,767,591 - 81,768,842 (-)	MPROMDB

RGD ID:

6834532

Promoter ID:

MM_KWN:34668

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Liver

Transcripts:

OTTMUST00000055914

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	3	81,779,391 - 81,779,891 (-)	MPROMDB

RGD ID:

6880954

Promoter ID:

EPDNEW_M3928

Type:

multiple initiation site

Name:

Tdo2_1

Description:

Mus musculus tryptophan 2,3-dioxygenase , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	3	81,975,751 - 81,975,811	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1928486	AgrOrtholog
Ensembl Genes	ENSMUSG00000028011	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000029645	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUST00000193879.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.3810	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.58.480	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Trp/Indoleamine_2_3_dOase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trp_2_3_dOase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:56720	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1928486	ENTREZGENE
NCBI Gene	56720	ENTREZGENE
PANTHER	PTHR10138	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPTOPHAN 2,3-DIOXYGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Trp_dioxygenase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tdo2	PhenoGen
Superfamily-SCOP	SSF140959	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	C5NSA7	ENTREZGENE, UniProtKB/TrEMBL
	P48776	ENTREZGENE
	Q8VCW3	ENTREZGENE, UniProtKB/TrEMBL
	T23O_MOUSE	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype