Bhlhe40 (basic helix-loop-helix family, member e40)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Bhlhe40 (basic helix-loop-helix family, member e40) Rattus norvegicus

Analyze

Symbol:

Bhlhe40

Name:

basic helix-loop-helix family, member e40

RGD ID:

68439

Description:

Predicted to enable several functions, including DNA-binding transcription factor binding activity; DNA-binding transcription repressor activity, RNA polymerase II-specific; and protein dimerization activity. Involved in several processes, including circadian rhythm; negative regulation of transcription by RNA polymerase II; and regulation of neuronal synaptic plasticity. Located in nucleus. Orthologous to human BHLHE40 (basic helix-loop-helix family member e40); PARTICIPATES IN hypoxia inducible factor pathway; INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1,3-dinitrobenzene; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

basic helix-loop-helix domain containing, class B2; Bhlhb2; class B basic helix-loop-helix protein 2; class E basic helix-loop-helix protein 40; Dec1; enhancer-of split and hairy-related protein 2; enhancer-of-split and hairy-related protein 2; SHARP-2; Sharp2; stimulated by retinoic acid 14; Stra13; Stra14

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	141,618,453 - 141,624,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	141,618,476 - 141,624,774 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	147,040,502 - 147,046,182 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	142,821,233 - 142,826,913 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	141,465,221 - 141,470,900 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	140,703,619 - 140,709,319 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	140,703,619 - 140,709,319 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	205,170,129 - 205,175,829 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	144,139,486 - 144,145,186 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	144,384,326 - 144,390,027 (+)	NCBI
Celera	4	130,269,971 - 130,275,671 (+)	NCBI		Celera
Cytogenetic Map	4	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

advanced sleep phase syndrome (ISO)

bipolar disorder (ISO)

COVID-19 (ISO)

genetic disease (ISO)

glioblastoma (ISO)

Myocardial Ischemia (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (EXP)

15-acetyldeoxynivalenol (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetaldehyde (ISO)

acrylamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

Azaspiracid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

buspirone (EXP)

butan-1-ol (ISO)

cadmium dichloride (ISO)

cadmium sulfate (ISO)

captan (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroacetaldehyde (ISO)

chloropicrin (ISO)

chloroprene (EXP)

chlorpromazine (ISO)

chromium atom (ISO)

chrysene (ISO)

Cinobufagin (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (EXP,ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP,ISO)

dichloroacetic acid (ISO)

dichloromethane (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenofibrate (EXP,ISO)

ferric oxide (ISO)

flutamide (EXP)

fluvastatin (ISO)

folic acid (ISO)

folpet (ISO)

formaldehyde (ISO)

furan (EXP)

gamma-hexachlorocyclohexane (EXP)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

glycine betaine (EXP)

Heptachlor epoxide (ISO)

hypochlorous acid (ISO)

ifosfamide (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

isobutanol (ISO)

isotretinoin (ISO)

ketamine (EXP)

lead(0) (ISO)

lead(2+) (ISO)

lead(II) chloride (ISO)

leflunomide (ISO)

lipopolysaccharide (EXP,ISO)

manganese(II) chloride (EXP)

mercury atom (ISO)

mercury dibromide (ISO)

mercury(0) (ISO)

metformin (EXP)

methidathion (ISO)

methotrexate (ISO)

methoxsalen (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

N-methyl-4-phenylpyridinium (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nickel sulfate (ISO)

nimesulide (EXP)

oxaliplatin (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

phenformin (EXP)

phenobarbital (ISO)

phenol (ISO)

phenylmercury acetate (ISO)

phosgene (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

progesterone (ISO)

quercetin (EXP,ISO)

quinolin-8-ol (ISO)

rac-lactic acid (ISO)

ranitidine (EXP)

resorcinol (ISO)

resveratrol (ISO)

rifampicin (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (ISO)

styrene (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamibarotene (ISO)

tamoxifen (ISO)

testosterone (ISO)

tetraphene (ISO)

thapsigargin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

Triptolide (ISO)

triptonide (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

undecane (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Yessotoxin (ISO)

zinc dichloride (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterior/posterior pattern specification (IBA)

circadian regulation of gene expression (IBA,IEA,ISO,ISS)

circadian rhythm (IEP,ISO,ISS)

entrainment of circadian clock by photoperiod (IEA,ISO)

negative regulation of DNA-binding transcription factor activity (IEA,ISO)

negative regulation of DNA-templated transcription (ISO,ISS)

negative regulation of transcription by RNA polymerase II (IEA,IMP,ISO)

nervous system development (NAS)

regulation of circadian rhythm (ISO,ISS)

regulation of neurogenesis (IBA)

regulation of neuronal synaptic plasticity (IEP,NAS)

regulation of transcription by RNA polymerase II (IBA)

response to light stimulus (IDA,IEP)

Cellular Component

cytoplasm (IEA)

nuclear body (IEA,ISO)

nucleus (IDA)

nucleus (ISO)

Molecular Function

bHLH transcription factor binding (ISO)

DNA binding (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO,ISS)

E-box binding (IEA,ISO,ISS)

MRF binding (IEA,ISO)

protein binding (ISO)

protein domain specific binding (IEA,ISO)

protein heterodimerization activity (IEA,ISO)

protein homodimerization activity (IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

sequence-specific double-stranded DNA binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

hypoxia inducible factor pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Dec1 and Dec2 are regulators of the mammalian molecular clock.	Honma S, etal., Nature 2002 Oct 24;419(6909):841-4.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	SHARPs: mammalian enhancer-of-split- and hairy-related proteins coupled to neuronal stimulation.	Rossner MJ, etal., Mol Cell Neurosci 1997;10(3-4):460-75.
10.	SHARPs: mammalian enhancer-of-split- and hairy-related proteins coupled to neuronal stimulation.	Rossner MJ, etal., Mol Cell Neurosci 1997;10(3-4):460-75.
11.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
12.	Gene expression of basic helix-loop-helix transcription factor, SHARP-2, is regulated by gonadotropins in the rat ovary and MA-10 cells.	Yamada K, etal., Biol Reprod 2004 Jan;70(1):76-82. Epub 2003 Sep 3.

Additional References at PubMed

PMID:12297495	PMID:12624110	PMID:12796501	PMID:14672706	PMID:14725860	PMID:15038852	PMID:15147242	PMID:15193144	PMID:15560782	PMID:15733865	PMID:17487425	PMID:18411297
PMID:18602890	PMID:19029909	PMID:19786558	PMID:20205554	PMID:21430201	PMID:26590300	PMID:26820676	PMID:27792527	PMID:28797635	PMID:29952285	PMID:30012868	PMID:35659652

Genomics

Comparative Map Data

Bhlhe40
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	141,618,453 - 141,624,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	141,618,476 - 141,624,774 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	147,040,502 - 147,046,182 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	142,821,233 - 142,826,913 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	141,465,221 - 141,470,900 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	140,703,619 - 140,709,319 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	140,703,619 - 140,709,319 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	205,170,129 - 205,175,829 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	144,139,486 - 144,145,186 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	144,384,326 - 144,390,027 (+)	NCBI
Celera	4	130,269,971 - 130,275,671 (+)	NCBI		Celera
Cytogenetic Map	4	q41	NCBI

BHLHE40
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	4,979,437 - 4,985,323 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	4,979,437 - 4,985,323 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	5,021,122 - 5,027,008 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	4,996,208 - 5,001,861 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	4,996,207 - 5,001,861	NCBI
Celera	3	4,959,047 - 4,964,811 (+)	NCBI		Celera
Cytogenetic Map	3	p26.1	NCBI
HuRef	3	4,954,421 - 4,960,188 (+)	NCBI		HuRef
CHM1_1	3	4,971,113 - 4,976,884 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	4,973,219 - 4,979,102 (+)	NCBI		T2T-CHM13v2.0

Bhlhe40
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	108,637,590 - 108,643,886 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	108,637,590 - 108,643,886 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	108,660,629 - 108,666,925 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	108,660,629 - 108,666,925 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	108,610,623 - 108,616,919 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	108,626,406 - 108,632,702 (+)	NCBI		MGSCv36	mm8
Celera	6	110,461,756 - 110,468,060 (+)	NCBI		Celera
Cytogenetic Map	6	E2	NCBI

Bhlhe40
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	8,463,018 - 8,468,877 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955421	8,463,337 - 8,468,877 (-)	NCBI	ChiLan1.0	ChiLan1.0

BHLHE40
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	5,028,217 - 5,033,968 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	5,028,515 - 5,032,470 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	3	4,927,487 - 4,933,215 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

BHLHE40
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	12,641,872 - 12,647,519 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	12,642,702 - 12,647,525 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	12,616,237 - 12,621,884 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	12,685,779 - 12,691,425 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	12,685,620 - 12,691,924 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	12,390,474 - 12,396,120 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	12,731,885 - 12,737,531 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	12,718,100 - 12,723,747 (-)	NCBI		UU_Cfam_GSD_1.0

Bhlhe40
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	11,360,673 - 11,365,809 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936577	4,315,977 - 4,322,032 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936577	4,316,099 - 4,321,193 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BHLHE40
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	61,526,116 - 61,533,674 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	61,526,121 - 61,533,686 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	67,830,821 - 67,836,984 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BHLHE40
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	41,049,673 - 41,055,365 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	41,049,712 - 41,055,360 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	125,612,281 - 125,617,974 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bhlhe40
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624773	15,413,365 - 15,420,123 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624773	15,413,400 - 15,418,220 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bhlhe40
16 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	130
Count of miRNA genes:	88
Interacting mature miRNAs:	117
Transcripts:	ENSRNOT00000009563
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat

Markers in Region

D4Wox44

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	141,623,426 - 141,623,565 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	140,708,592 - 140,708,730	NCBI	Rnor6.0
Rnor_5.0	4	205,175,102 - 205,175,240	UniSTS	Rnor5.0
RGSC_v3.4	4	144,144,459 - 144,144,597	UniSTS	RGSC3.4
Celera	4	130,274,944 - 130,275,082	UniSTS
Cytogenetic Map	4	q41	UniSTS

RH139327

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	141,621,578 - 141,621,825 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	140,706,744 - 140,706,990	NCBI	Rnor6.0
Rnor_5.0	4	205,173,254 - 205,173,500	UniSTS	Rnor5.0
RGSC_v3.4	4	144,142,611 - 144,142,857	UniSTS	RGSC3.4
Celera	4	130,273,096 - 130,273,342	UniSTS
RH 3.4 Map	8	866.1	UniSTS
Cytogenetic Map	4	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	33	41	28	16	28	8	11	31	33	21	11	8
Low		10	16	13	3	13			43	2	20
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB096137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF009330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000009563 ⟹ ENSRNOP00000009564

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	141,618,476 - 141,624,774 (+)	Ensembl
Rnor_6.0 Ensembl	4	140,703,619 - 140,709,319 (+)	Ensembl

RefSeq Acc Id:

NM_053328 ⟹ NP_445780

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	141,618,453 - 141,624,154 (+)	NCBI
Rnor_6.0	4	140,703,619 - 140,709,319 (+)	NCBI
Rnor_5.0	4	205,170,129 - 205,175,829 (+)	NCBI
RGSC_v3.4	4	144,139,486 - 144,145,186 (+)	RGD
Celera	4	130,269,971 - 130,275,671 (+)	RGD

Sequence:

show sequence

TTCCCTCCCGCCTCTCCACCCGCCCCACTTCTCATTCACTTGGCTCGCACGGCGCAGACAGCCA
GGCGAGCACACACCGCCAGTCTGTGTGCAGAGCGGGAGCCAGAAGCCGTGGGGGACACCCGGTC
ATGCACGCCCCCAACTGAAGCGACACCTCAAAGCCGCAGCTCCTGGCAGCCCAGGCCATTGCAA
GAAGCTCAGGCTAGCTCATAGGAACATACCCCTTGAGACCCTCGGATCCTCCCTTCCAGGCCAG
TCCTCTCTCAGACTCTCTGCTAAGTGCAGACAGGAGCGCACAGTGGCCCCTGCTCGCCGCATCA
TGGAGCGGATCCCCAGCGCGCAACCACCTCCTACCTGCCTGCCCAAAACGCCAGGGCTGGAGCA
CGGAGACCTGTCAGGGATGGATTTTGCCCACATGTACCAAGTGTACAAGTCCAGGCGGGGAATA
AAACGGAGCGAGGACAGCAAGGAAACTTACAAATTGCCGCACCGGTTGATTGAGAAAAAGAGAC
GTGACCGGATTAACGAGTGCATTGCCCAGCTGAAGGATCTCCTACCCGAACATCTCAAACTTAC
TACTTTGGGTCACTTGGAGAAAGCAGTGGTTCTCGAGCTGACGCTGAAGCACGTGAAAGCATTG
ACAAACCTAATTGATCAGCAGCAGCAGAAAATCATGGCCCTGCAGAGCGGTTTACAAGCTGGTG
ATCTGTCGGGAAAGAATATTGAGGCAGGACAAGAAATGTTCTGCTCCGGTTTCCAGACCTGTGC
CCGGGAGGTACTTCAGTACCTGGCCAAGCATGAAAACACTAGGGACCTGAAGTCTTCCCAGCTT
GTCACTCATCTCCACCGTGTGGTCTCTGAACTCCTGCAGGGTAGTGCTTCCAGGAAACCATTGG
ACTCAGCTCCCAAACCCGTGGACTTCAAAGAGAAGCCCAGCTTCCTAGCCAAGGGATCAGAAGG
CCCTGGGAAAAACTGTGTGCCAGTCATCCAGAGGACTTTTGCTCCCTCGGGCGGGGAGCAGAGT
GGTAGTGACACGGACACAGACAGTGGCTACGGAGGCGAATTGGAGAAGGGTGACTTGCGCAGTG
AGCAACCCTACTTCAAGAGCGATCACGGACGCAGGTTCACCGTGGGAGAACGCGTCAGCACAAT
TAAGCAAGAATCTGAAGAGCCCCCCACCAAAAAGAGCCGAATGCAGCTCTCAGATGAGGAAGGC
CACTTCGTGGGCAGTGACCTGATGGGTTCCCCATTTCTTGGGCCTCACCCACATCAGCCTCCCT
TTTGCCTGCCCTTCTATCTCATCCCACCATCGGCCACTGCCTATCTGCCTATGCTGGAGAAATG
CTGGTATCCGACCTCTGTGCCACTGTTATACCCAGGCCTCAACACCTCAGCAGCAGCCCTCTCC
AGCTTCATGAACCCAGACAAGATCCCAACTCCCTTGCTCCTGCCCCAGAGACTCCCTTCTCCCT
TGGCACATTCGTCCCTTGACTCTTCAGCCTTGCTCCAGGCCCTGAAGCAGATCCCTCCTTTAAA
CTTAGAAACCAAAGACTAAACTCTTGAGGGCGAATCTCCTGCTGCTTTGCTTTTCCTTTCCCCA
CTAATTCCAAGACCACAAAAGGTTTCTGTGAGTGCAGAGAGATCGGCCCACCATGCAGACCCAC
AGAGAAGATTCAGAATGTGTGTGAGAGTGAGTGTGTGAGTGCGCGTGCGTGTGCTTGTATGTGT
GTTTATAGATGTAGGACATTAAGTTCCTTCTGACACAGGGAAGATGTGAGAAGGATGGCCTGAC
ATCAGATGACAAGAGGTCTATAGCACATCTCTGGGCTTTTCCCTACCCAGAGAAGAGCCCCCTT
TGATACAAATCAGTTGGATTTTCATATGCTTCAAAGGCTTGATCTGTGAGTCACTCCAGTTTGG
GACATAGGTCTGTCTGTGGCTTTGAGAAAAGGTACTTTCAAAAGAGGGCTTTCCAGAGCACAGC
TCACAGCCAGCTGTTAGGACCCCACCCTTCTCCTTTATTGTGGAGGTGACTCACAGCAGACTGA
CAGTGGTCAGACTGAGCTTTCTGCTAAGGTGGTGAGGTAGCCAACACTGGCATGTCTCGGTAGT
GGTTTGGGCAAATTTCCGCAGGTCTCTTCCCCCAACCCTGCCTCTGATGAATAAAGACAATGAG
TACAGTTCCTTAATTCAGGCTTTTGTGACTAGCTTACTACGGAACCGAAAATGGTCCCCTTTGT
ACAAGCCGAGCTGTTATGGAATCACGGTGAACCAGACCCAGGTCTGTGGCACCTGTTTGTTTGT
TTTTTTTTTTTTTTTTTTTTAGCTCTCATTTCTACGGCATGCTTTCCAAGGAACCAAAGGAGGG
TCTCAGAGATGCCCCCTCGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_445780	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB63587	(Get FASTA)	NCBI Sequence Viewer
	BAD01588	(Get FASTA)	NCBI Sequence Viewer
	EDL91480	(Get FASTA)	NCBI Sequence Viewer
	O35780	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_445780 ⟸ NM_053328

- UniProtKB:

Q76JQ4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERIPSAQPPPTCLPKTPGLEHGDLSGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKR
RDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIMALQSGLQAG
DLSGKNIEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGSASRKPL
DSAPKPVDFKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSDTDTDSGYGGELEKGDLRS
EQPYFKSDHGRRFTVGERVSTIKQESEEPPTKKSRMQLSDEEGHFVGSDLMGSPFLGPHPHQPP
FCLPFYLIPPSATAYLPMLEKCWYPTSVPLLYPGLNTSAAALSSFMNPDKIPTPLLLPQRLPSP
LAHSSLDSSALLQALKQIPPLNLETKD

hide sequence

RefSeq Acc Id:

ENSRNOP00000009564 ⟸ ENSRNOT00000009563

Protein Domains

bHLH Orange

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35780-F1-model_v2	AlphaFold	O35780	1-411	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693283

Promoter ID:

EPDNEW_R3808

Type:

initiation region

Name:

Bhlhe40_1

Description:

basic helix-loop-helix family, member e40

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	140,703,686 - 140,703,746	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68439	AgrOrtholog
BioCyc Gene	G2FUF-43448	BioCyc
Ensembl Genes	ENSRNOG00000007152	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000009564	ENTREZGENE
	ENSRNOP00000009564.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009563	ENTREZGENE
	ENSRNOT00000009563.3	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.250.980	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	bHLH_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Orange_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79431	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	79431	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, HES-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CLASS E BASIC HELIX-LOOP-HELIX PROTEIN 40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Hairy_orange	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Bhlhe40	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ORANGE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HLH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ORANGE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Orange domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47459	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC233060
UniProt	BHE40_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q76JQ4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-19	Bhlhe40	basic helix-loop-helix family, member e40	Bhlhb2	basic helix-loop-helix domain containing, class B2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Bhlhb2	basic helix-loop-helix domain containing, class B2			Name updated	70584	APPROVED
2002-02-27	Bhlhb2	basic helix-loop-helix domain containing, class B2			Symbol and Name updated to reflect Human and Mouse nomenclature	70292	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the suprachiasmic nucleus of the hypothalamus (SCN) in a circadian fashion	625726
gene_expression	expression in neurons of the cerebral cortex is induced by kainic acid	68312
gene_process	expression may be associated with neuronal stimulation	728119
gene_product	member of a family of neuronal bHLH proteins	728119

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)