S1pr2 (sphingosine-1-phosphate receptor 2)

Advanced Search (OLGA)

Gene: S1pr2 (sphingosine-1-phosphate receptor 2) Rattus norvegicus

Analyze

Symbol:

S1pr2

Name:

sphingosine-1-phosphate receptor 2

RGD ID:

68334

Description:

Enables G protein-coupled peptide receptor activity. Acts upstream of or within G protein-coupled receptor signaling pathway; negative regulation of smooth muscle cell migration; and negative regulation of vascular associated smooth muscle cell proliferation. Predicted to be located in postsynapse. Predicted to be active in several cellular components, including glutamatergic synapse; plasma membrane; and presynapse. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 68. Orthologous to human S1PR2 (sphingosine-1-phosphate receptor 2); PARTICIPATES IN sphingosine 1-phosphate signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

AGR16; Edg5; endothelial differentiation G-protein coupled receptor 5; endothelial differentiation, sphingolipid G-protein-coupled receptor, 5; G-protein coupled receptor 13; G-protein coupled receptor H218; Gpcr13; GPCR18; H218; S1P receptor 2; S1P receptor Edg-5; S1P2; snGPCR18; sphingosine 1-phosphate receptor 2; sphingosine 1-phosphate receptor Edg-5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	S1PR2 (sphingosine-1-phosphate receptor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	S1pr2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	S1pr2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	S1PR2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	S1PR2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	S1pr2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	S1PR2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	S1PR2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	S1pr2 (sphingosine-1-phosphate receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	S1pr2 (sphingosine-1-phosphate receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	S1PR2 (sphingosine-1-phosphate receptor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	s1pr2 (sphingosine-1-phosphate receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	s1pr2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	27,779,452 - 27,790,344 (-)	NCBI		GRCr8
mRatBN7.2	8	19,503,276 - 19,514,169 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,502,627 - 19,523,574 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,522,690 - 23,533,589 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	21,820,536 - 21,831,435 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	19,732,951 - 19,743,843 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	21,984,914 - 21,995,806 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	21,984,914 - 21,995,806 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,041,266 - 22,061,702 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	19,989,867 - 20,000,759 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	19,989,866 - 20,000,759 (-)	NCBI
Celera	8	20,897,794 - 20,908,686 (-)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive nonsyndromic deafness 68 (ISO,ISS)

Experimental Diabetes Mellitus (ISO)

familial hypercholesterolemia (ISO)

Fibrosis (ISO)

genetic disease (ISO)

heart disease (ISO)

immunodeficiency 35 (ISO)

Neoplasm Invasiveness (ISO)

non-Hodgkin lymphoma (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

apigenin (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

cocaine (EXP)

crocidolite asbestos (ISO)

D-glucose (EXP)

dextran sulfate (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

diuron (EXP)

endosulfan (EXP)

fenthion (ISO)

flavonoids (EXP)

flutamide (EXP)

FR900359 (ISO)

furan (EXP)

gentamycin (EXP)

glucose (EXP)

JTE-013 (EXP)

ketamine (EXP)

leflunomide (ISO)

lipopolysaccharide (EXP)

methapyrilene (ISO)

methotrexate (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

ozone (EXP,ISO)

paracetamol (EXP)

pirinixic acid (EXP)

resveratrol (ISO)

riddelliine (EXP)

rotenone (ISO)

Soman (EXP)

sphingosine 1-phosphate (EXP,ISO)

streptozocin (EXP)

taurocholic acid (ISO)

taurolithocholic acid (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IEA,ISO)

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA)

excitatory postsynaptic potential (IEA,ISO)

filopodium assembly (IEA,ISO)

G protein-coupled receptor signaling pathway (IDA,ISO)

negative regulation of excitatory postsynaptic potential (IEA,ISO)

negative regulation of smooth muscle cell migration (IGI)

negative regulation of vascular associated smooth muscle cell proliferation (IGI)

positive regulation of establishment of endothelial barrier (IEA,ISO)

positive regulation of peptidyl-threonine phosphorylation (IEA,ISO)

regulation of metabolic process (IBA)

regulation of postsynapse assembly (IEA,ISO)

sphingosine-1-phosphate receptor signaling pathway (IBA,IEA,ISO)

Cellular Component

cytoplasm (IBA)

glutamatergic synapse (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

postsynapse (IEA)

presynapse (IEA,ISO)

Molecular Function

G protein-coupled peptide receptor activity (IDA,IEA,ISO)

G protein-coupled receptor activity (IDA)

G protein-coupled receptor binding (IEA,ISO)

integrin binding (IEA,ISO)

protein binding (ISO)

sphingosine-1-phosphate receptor activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

sphingosine 1-phosphate signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of cDNAs encoding two G protein-coupled receptors for lysosphingolipids.	An S, etal., FEBS Lett 1997 Nov 17;417(3):279-82.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Cloning and characterization of a putative G-protein coupled receptor potentially involved in development.	MacLennan AJ, etal., Mol Cell Neurosci 1994 Jun;5(3):201-9.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Molecular cloning of a novel putative G protein-coupled receptor expressed in the cardiovascular system.	Okazaki H, etal., Biochem Biophys Res Commun 1993 Feb 15;190(3):1104-9.
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Novel Adipokine, FAM19A5, Inhibits Neointima Formation After Injury Through Sphingosine-1-Phosphate Receptor 2.	Wang Y, etal., Circulation. 2018 Jul 3;138(1):48-63. doi: 10.1161/CIRCULATIONAHA.117.032398. Epub 2018 Feb 16.

Additional References at PubMed

PMID:10383399	PMID:11553273	PMID:15713536	PMID:18535287	PMID:19151362	PMID:19636535	PMID:21932398	PMID:22139303	PMID:22406263	PMID:22505286	PMID:23106337	PMID:24064301
PMID:24700501	PMID:24851274	PMID:25575056	PMID:27317945	PMID:27814635	PMID:28493876	PMID:29266713	PMID:29401609	PMID:31603252	PMID:33452855	PMID:33880585	PMID:34224319
PMID:35263212

Genomics

Comparative Map Data

S1pr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	27,779,452 - 27,790,344 (-)	NCBI		GRCr8
mRatBN7.2	8	19,503,276 - 19,514,169 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,502,627 - 19,523,574 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,522,690 - 23,533,589 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	21,820,536 - 21,831,435 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	19,732,951 - 19,743,843 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	21,984,914 - 21,995,806 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	21,984,914 - 21,995,806 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,041,266 - 22,061,702 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	19,989,867 - 20,000,759 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	19,989,866 - 20,000,759 (-)	NCBI
Celera	8	20,897,794 - 20,908,686 (-)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

S1PR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,221,433 - 10,231,331 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,221,433 - 10,231,331 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,332,109 - 10,342,007 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,193,109 - 10,202,948 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	10,195,519 - 10,202,929	NCBI
Celera	19	10,227,498 - 10,237,335 (-)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	9,912,564 - 9,922,403 (-)	NCBI		HuRef
CHM1_1	19	10,332,386 - 10,342,216 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,347,578 - 10,357,458 (-)	NCBI		T2T-CHM13v2.0

S1pr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	20,877,248 - 20,888,089 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	20,873,657 - 20,888,077 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	20,965,952 - 20,976,793 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	20,962,361 - 20,976,781 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	20,770,396 - 20,781,237 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	20,716,360 - 20,727,183 (-)	NCBI		MGSCv36	mm8
Celera	9	18,234,642 - 18,245,483 (-)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI
cM Map	9	7.68	NCBI

S1pr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	1,529,428 - 1,530,486 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	1,528,963 - 1,530,527 (-)	NCBI	ChiLan1.0	ChiLan1.0

S1PR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	15,138,454 - 15,148,379 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	14,137,059 - 14,151,513 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	9,771,888 - 9,781,944 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	10,436,094 - 10,443,955 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	10,436,502 - 10,437,563 (-)	Ensembl	panpan1.1		panPan2

S1PR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,855,505 - 50,862,985 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,860,591 - 50,861,649 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	50,725,039 - 50,732,522 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	51,376,931 - 51,384,414 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	51,376,966 - 51,384,411 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	50,583,043 - 50,590,527 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	51,012,253 - 51,019,735 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	51,252,973 - 51,260,455 (+)	NCBI		UU_Cfam_GSD_1.0

S1pr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	209,767,641 - 209,774,934 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	579,867 - 586,885 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	579,771 - 587,077 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

S1PR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,049,270 - 69,057,270 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,050,396 - 69,057,270 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	69,377,718 - 69,384,593 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

S1PR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	9,281,130 - 9,291,705 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	9,283,529 - 9,284,590 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	10,755,523 - 10,766,082 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

S1pr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	2,390,742 - 2,394,106 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	2,371,750 - 2,419,330 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in S1pr2
32 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	267
Count of miRNA genes:	169
Interacting mature miRNAs:	192
Transcripts:	ENSRNOT00000028034
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	24597739	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317882	Alcrsp24	Alcohol response QTL 24	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	8	1	25902202	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat

Markers in Region

RH127910

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	19,503,411 - 19,503,601 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	21,985,050 - 21,985,239	NCBI	Rnor6.0
Rnor_5.0	8	22,041,403 - 22,041,592	UniSTS	Rnor5.0
RGSC_v3.4	8	19,990,003 - 19,990,192	UniSTS	RGSC3.4
Celera	8	20,897,930 - 20,898,119	UniSTS
RH 3.4 Map	8	182.1	UniSTS
Cytogenetic Map	8	q13	UniSTS

UniSTS:474719

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	19,505,275 - 19,505,875 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	21,986,914 - 21,987,513	NCBI	Rnor6.0
Rnor_5.0	8	22,043,267 - 22,043,866	UniSTS	Rnor5.0
RGSC_v3.4	8	19,991,867 - 19,992,466	UniSTS	RGSC3.4
Celera	8	20,899,794 - 20,900,393	UniSTS
Cytogenetic Map	8	q13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	6	108	54	20	18	20	13	3	93	65	103	45	3
Low	15	33	173	127	51	127	23	42	157	50	24		21
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB016931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC135310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF022138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF090995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U10699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028034 ⟹ ENSRNOP00000028034

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,503,263 - 19,523,574 (-)	Ensembl
Rnor_6.0 Ensembl	8	21,984,914 - 21,995,806 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107018 ⟹ ENSRNOP00000080559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,502,627 - 19,514,332 (-)	Ensembl

RefSeq Acc Id:

NM_017192 ⟹ NP_058888

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	27,779,452 - 27,790,344 (-)	NCBI
mRatBN7.2	8	19,503,276 - 19,514,169 (-)	NCBI
Rnor_6.0	8	21,984,914 - 21,995,806 (-)	NCBI
Rnor_5.0	8	22,041,266 - 22,061,702 (-)	NCBI
RGSC_v3.4	8	19,989,867 - 20,000,759 (-)	RGD
Celera	8	20,897,794 - 20,908,686 (-)	RGD

Sequence:

show sequence

CCCCCTCGAGCACAGCCAACAGTCACCAAAGTCAGCCACTGGCTGTCCCGGGGCGCAGACGCCA
AGGCCACTCAGGCCAGGGCAGGGACCCTGGCCGGCCTAGCCAGTGCTCAGTCCCATGGCCCCGG
CCGGCCACTGAGCCCCACCATGGGCGGTTTATACTCAGAGTACCTCAATCCTGAGAAGGTTCAG
GAACACTACAATTACACCAAGGAGACGCTGGACATGCAGGAGACGCCCTCCCGCAAGGTGGCCT
CCGCCTTCATCATCATTTTATGCTGTGCCATCGTGGTGGAGAACCTTCTGGTGCTAATCGCAGT
GGCCAGGAACAGCAAGTTCCACTCAGCCATGTACCTGTTCCTCGGCAACCTGGCAGCCTCCGAC
CTGCTGGCAGGCGTGGCCTTCGTGGCCAACACCTTGCTCTCCGGACCTGTCACCCTGTCCTTAA
CTCCCTTGCAGTGGTTTGCCCGAGAGGGTTCAGCCTTCATCACGCTCTCTGCCTCGGTCTTCAG
CCTCCTGGCCATTGCCATCGAGAGACAAGTGGCCATCGCCAAGGTCAAGCTCTACGGCAGTGAC
AAAAGCTGTCGAATGTTGATGCTCATTGGGGCCTCTTGGCTGATATCGCTGATTCTGGGTGGCT
TGCCCATCCTGGGCTGGAATTGTCTGGACCATCTGGAGGCTTGCTCCACTGTGCTGCCCCTCTA
TGCTAAGCACTATGTGCTCTGCGTGGTCACCATCTTCTCTGTCATCTTACTGGCTATCGTGGCC
TTGTACGTCCGAATCTACTTCGTAGTCCGCTCAAGCCATGCGGACGTTGCTGGTCCTCAGACGC
TGGCCCTGCTCAAGACAGTCACCATCGTACTGGGTGTTTTCATCATCTGCTGGCTGCCGGCTTT
TAGCATCCTTCTCTTAGACTCTACCTGTCCCGTCCGGGCCTGTCCTGTCCTCTACAAAGCCCAT
TATTTCTTTGCCTTCGCCACCCTCAACTCTCTGCTCAACCCTGTCATCTATACATGGCGTAGCC
GGGACCTTCGGAGGGAGGTACTGAGGCCCCTGCTGTGCTGGCGGCAGGGGAAGGGAGCAACAGG
GCGCAGAGGTGGGAACCCTGGTCACCGACTCCTGCCCCTCCGCAGCTCCAGCTCCCTGGAGAGA
GGCTTGCATATGCCTACATCGCCAACATTTCTGGAGGGCAACACAGTGGTCTGAGGGGAAATGT
GAACTGATCTGTAACCAAGCCACAGAGAGAGCTCTGTGGGGAGAGACCAGGTGACCTCATCATG
TCCCTCAGTGCCACAGGTCTGGAGGAACTGACCACGGCTCATAGGTCAGGTGGCCAACGGAGGC
ACTGACTAATCAGATTGTAGTACTGTGACTGTGGGGACCATTAAGGGTCTAGGGGGACAGCAGG
CTCGAGTTTAGGGCTAGACATTTGCCACTTGGTACATAGGGTGTCGGCATCCTGTCTGTCCTAT
CTTCCAGCTTCCCGGTTCCCTTCCTGCCTCCTCCTTTTAAGGGCCTCTCTACATAGCCCCGGCT
GGCTAGAGCTTGCTGTGCAGACCAGGCTGACCTGGACCTCCCAGAGATAGATCAACTAACTGTG
TCCTGAGTGCTGGGATTTTAAAGCCGTGTGCCCCCACACCCGGCTCCTGCCACCTTCCAGAAGC
AATCTTAGGCCACTTGTTGAGGAAACACTCTCCCCAGAGGACCCAAGCCTTCTTCCCTGTCTCT
CTGAGGCCTGAATCCACAGCTTCCCCATTTTATCAACTGCTGCTTCTTCCCTTTCCTTCTGTGT
TCAGGGGAAACCACTGTGGGGGCAGGGAGGGGTCCTGGGATCCCAGTTTTTATGCTCAGATCTC
ACTGAGCACTTGCTTTATTGGGGAGCAGAGAGGAATCAGCTGAGGCAGTGTGGGGCAGATGTTG
AGGAGAATTTGGGCTTCCTGGTGAGAAAACTCTAGGGGAGGCGTTGGTTATTCCTGGAACCCAG
CCTCTCTCCCCACGAACTCTTCACACCCGCAGCCTTGAGCTGGATGCAAAGGCTGCTTTCAATT
TGTCTTTGTAGTTTTGTTTTGTTTTGTTTTGTTTTTTTAAATTGGGACAGGATCTCACGTACCC
CAGGCTGGCCTCCGACTCACTATGTAGCCAAGGCTGGCTTTGGACTTCTGACCCTCCTGCCTCC
GCTTCTGGAGTGCAGGTATTACAAGGGTGTACCACCACCACCACCACCACCAACAACAACAACA
ACAACAACACCTGTCTTGAAAACTATCATGAATGACATGGTTCACATAGCCTTGGGTGGCCAAG
GACATCCCGGATACTCTTATGGCATCTTCCTTGAAGGACTTTGCTAAATCCTGTGGAGAAGTAG
AAAATCCAATACGGTACAAACGGTATTTATGTGTGTCTGTGTATCAGTGTGGGGTCTGTGACCT
CCTATCCCAGTGTGGGTGCTGTCTGACCTCTTATGTGCACATCCGTGTCAAGACTGCTAGAGAG
ATGGACGGGGGTGTGTGTGCTTGTGGGGGTCTAGCCATGATCAGGCCTCCTGGGAATTGCTGAA
TCATCTCTCCCACACACAGACACACACCTCCGCCTTAAAGAAATGTGTGAAAGAAAAGGCTGAG
GAAGGGGAGATTTGGGAGGCAAGGAGCCAGTCGGGAGTGTGTCTCCCCTCATACAGCTTCCCAG
ATGTCCCCCTTGTGCTGGAAACCCAGAACTGGGCCAATAAACAGTTCAATTTCTCTTGAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058888	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA19241	(Get FASTA)	NCBI Sequence Viewer
	AAC53494	(Get FASTA)	NCBI Sequence Viewer
	AAG24259	(Get FASTA)	NCBI Sequence Viewer
	BAA32454	(Get FASTA)	NCBI Sequence Viewer
	EDL78338	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028034.3
	ENSRNOP00000080559.1
	ENSRNOP00055018159
	ENSRNOP00060040523
	ENSRNOP00065014767
GenBank Protein	P47752	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058888 ⟸ NM_017192

- UniProtKB:

Q54AI6 (UniProtKB/Swiss-Prot), P47752 (UniProtKB/Swiss-Prot), A6JNM8 (UniProtKB/TrEMBL), A0A8L2QF47 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGGLYSEYLNPEKVQEHYNYTKETLDMQETPSRKVASAFIIILCCAIVVENLLVLIAVARNSKF
HSAMYLFLGNLAASDLLAGVAFVANTLLSGPVTLSLTPLQWFAREGSAFITLSASVFSLLAIAI
ERQVAIAKVKLYGSDKSCRMLMLIGASWLISLILGGLPILGWNCLDHLEACSTVLPLYAKHYVL
CVVTIFSVILLAIVALYVRIYFVVRSSHADVAGPQTLALLKTVTIVLGVFIICWLPAFSILLLD
STCPVRACPVLYKAHYFFAFATLNSLLNPVIYTWRSRDLRREVLRPLLCWRQGKGATGRRGGNP
GHRLLPLRSSSSLERGLHMPTSPTFLEGNTVV

hide sequence

Ensembl Acc Id:

ENSRNOP00000028034 ⟸ ENSRNOT00000028034

Ensembl Acc Id:

ENSRNOP00000080559 ⟸ ENSRNOT00000107018

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P47752-F1-model_v2	AlphaFold	P47752	1-352	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695770

Promoter ID:

EPDNEW_R6294

Type:

initiation region

Name:

S1pr2_1

Description:

sphingosine-1-phosphate receptor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	21,995,847 - 21,995,907	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68334	AgrOrtholog
BioCyc Gene	G2FUF-31447	BioCyc
Ensembl Genes	ENSRNOG00000020653	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055013081	UniProtKB/Swiss-Prot
	ENSRNOG00060027995	UniProtKB/Swiss-Prot
	ENSRNOG00065011906	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028034.5	UniProtKB/TrEMBL
	ENSRNOT00000107018.1	UniProtKB/Swiss-Prot
	ENSRNOT00055022387	UniProtKB/Swiss-Prot
	ENSRNOT00060048608	UniProtKB/Swiss-Prot
	ENSRNOT00065019323	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	EDG5_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S1P_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29415	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	29415	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR22750:SF17	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	S1pr2	PhenoGen
PRINTS	EDG5RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S1PRECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020653	RatGTEx
	ENSRNOG00055013081	RatGTEx
	ENSRNOG00060027995	RatGTEx
	ENSRNOG00065011906	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QF47	ENTREZGENE, UniProtKB/TrEMBL
	A6JNM8	ENTREZGENE, UniProtKB/TrEMBL
	P47752	ENTREZGENE
	Q54AI6	ENTREZGENE
	S1PR2_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q54AI6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-20	S1pr2	sphingosine-1-phosphate receptor 2	Edg5	endothelial differentiation, sphingolipid G-protein-coupled receptor, 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Edg5	endothelial differentiation, sphingolipid G-protein-coupled receptor, 5			Name updated	70584	APPROVED
2002-02-20	Edg5	endothelial differentiation, sphingolipid G-protein-coupled receptor, 5			Symbol and Name updated to reflect Human and Mouse nomenclature	70282	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains Src homology 2 domains	68254

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)