Rab2a (RAB2A, member RAS oncogene family)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rab2a (RAB2A, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab2a

Name:

RAB2A, member RAS oncogene family

RGD ID:

68323

Description:

Enables GTP binding activity. Predicted to be involved in Golgi organization and vesicle-mediated transport. Located in several cellular components, including Golgi membrane; neuronal cell body; and perinuclear region of cytoplasm. Is active in synaptic vesicle membrane. Orthologous to human RAB2A (RAB2A, member RAS oncogene family); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; Rab family mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Rab2; RAB2, member RAS oncogene family; ras-related protein Rab-2A

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB2A (RAB2A, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rab2a (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab2a (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB2A (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB2A (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab2a (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB2A (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB2A (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab2a (RAB2A, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RAB2B (RAB2B, member RAS oncogene family)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	RAB2A (RAB2A, member RAS oncogene family)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab2a (RAB2A, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab2a (RAB2A, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-108	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab2a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	21,676,017 - 21,740,035 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	21,676,129 - 21,739,899 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	23,908,990 - 23,971,652 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	25,496,252 - 25,558,865 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	25,276,527 - 25,339,148 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	21,632,654 - 21,696,721 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	21,632,926 - 21,695,519 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	26,385,934 - 26,449,989 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	22,389,585 - 22,452,198 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	22,389,584 - 22,452,198 (+)	NCBI
Celera	5	20,943,721 - 21,006,339 (+)	NCBI		Celera
Cytogenetic Map	5	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

CHARGE syndrome (ISO)

genetic disease (ISO)

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

acetylsalicylic acid (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

caffeine (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dichlorine (EXP)

elemental selenium (ISO)

Enterolactone (ISO)

ethanol (EXP)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (EXP)

gentamycin (EXP)

glyphosate (EXP)

hydrogen cyanide (ISO)

hydroxytyrosol (ISO)

ivermectin (ISO)

mercury dichloride (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

nicotine (ISO)

nimesulide (EXP)

ozone (EXP,ISO)

paracetamol (EXP)

paraquat (EXP)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (ISO)

piroxicam (ISO)

potassium cyanide (ISO)

raloxifene (ISO)

resveratrol (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

thapsigargin (EXP)

tipifarnib (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

troglitazone (ISO)

uranium atom (ISO)

valproic acid (ISO)

vitamin E (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum to Golgi vesicle-mediated transport (ISO)

Golgi organization (IEA,ISO,ISS)

protein transport (IEA)

Rab protein signal transduction (IC)

vesicle-mediated transport (IBA)

Cellular Component

acrosomal vesicle (IEA)

endoplasmic reticulum membrane (IDA)

endoplasmic reticulum-Golgi intermediate compartment membrane (IEA)

Golgi apparatus (IBA,IEA,ISO)

Golgi membrane (IBA,IDA)

melanosome (IEA)

membrane (IDA)

neuronal cell body (IDA)

perinuclear region of cytoplasm (IDA)

synaptic vesicle membrane (EXP,IDA,IEP)

Molecular Function

GDP binding (IEA,ISO,ISS)

GTP binding (IBA,IDA,IEA,ISO,ISS)

GTPase activity (IBA,IEA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin responsive facilitative sugar transporter mediated glucose transport pathway (ISO)

Rab family mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Rho proteins are localized with different membrane compartments involved in vesicular trafficking in anterior pituitary cells.	Cussac D, etal., Mol Cell Endocrinol. 1996 May 31;119(2):195-206.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rab proteins in endocytosis and Glut4 trafficking.	Kaddai V, etal., Acta Physiol (Oxf). 2008 Jan;192(1):75-88.
4.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
5.	The organization of the endoplasmic reticulum and the intermediate compartment in cultured rat hippocampal neurons.	Krijnse-Locker J, etal., Mol Biol Cell. 1995 Oct;6(10):1315-32.
6.	The GLUT4 code.	Larance M, etal., Mol Endocrinol. 2008 Feb;22(2):226-33. Epub 2007 Aug 23.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Quantitative analysis of synaptic vesicle Rabs uncovers distinct yet overlapping roles for Rab3a and Rab27b in Ca2+-triggered exocytosis.	Pavlos NJ, etal., J Neurosci. 2010 Oct 6;30(40):13441-53. doi: 10.1523/JNEUROSCI.0907-10.2010.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.	Rab2 interacts directly with atypical protein kinase C (aPKC) iota/lambda and inhibits aPKCiota/lambda-dependent glyceraldehyde-3-phosphate dehydrogenase phosphorylation.	Tisdale EJ J Biol Chem 2003 Dec 26;278(52):52524-30. Epub 2003 Oct 21.
15.	The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.	Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.
16.	Four additional members of the ras gene superfamily isolated by an oligonucleotide strategy: molecular cloning of YPT-related cDNAs from a rat brain library.	Touchot N, etal., Proc Natl Acad Sci U S A 1987 Dec;84(23):8210-4.
17.	GLUT4 translocation: the last 200 nanometers.	Watson RT and Pessin JE, Cell Signal. 2007 Nov;19(11):2209-17. Epub 2007 Jun 21.
18.	Insulin action on glucose transporters through molecular switches, tracks and tethers.	Zaid H, etal., Biochem J. 2008 Jul 15;413(2):201-15.

Additional References at PubMed

PMID:11042173	PMID:16034420	PMID:17488287	PMID:17562788	PMID:17684057	PMID:17897319	PMID:19056867	PMID:20458337	PMID:21630459	PMID:21700703	PMID:23376485	PMID:23533145
PMID:24625528	PMID:29476059

Genomics

Comparative Map Data

Rab2a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	21,676,017 - 21,740,035 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	21,676,129 - 21,739,899 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	23,908,990 - 23,971,652 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	25,496,252 - 25,558,865 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	25,276,527 - 25,339,148 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	21,632,654 - 21,696,721 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	21,632,926 - 21,695,519 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	26,385,934 - 26,449,989 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	22,389,585 - 22,452,198 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	22,389,584 - 22,452,198 (+)	NCBI
Celera	5	20,943,721 - 21,006,339 (+)	NCBI		Celera
Cytogenetic Map	5	q13	NCBI

RAB2A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	60,516,910 - 60,623,644 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	60,516,936 - 60,623,644 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	61,429,469 - 61,536,203 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	61,592,113 - 61,696,183 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	61,592,112 - 61,696,183	NCBI
Celera	8	57,418,606 - 57,523,216 (+)	NCBI		Celera
Cytogenetic Map	8	q12.1-q12.2	NCBI
HuRef	8	56,917,062 - 57,023,312 (+)	NCBI		HuRef
CHM1_1	8	61,481,468 - 61,587,847 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	60,940,688 - 61,047,387 (+)	NCBI		T2T-CHM13v2.0

Rab2a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	8,535,661 - 8,607,708 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	8,535,644 - 8,607,778 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	8,535,469 - 8,607,702 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	8,535,644 - 8,607,778 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	8,462,791 - 8,534,849 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	8,462,791 - 8,534,849 (+)	NCBI		MGSCv36	mm8
Celera	4	8,374,576 - 8,447,455 (+)	NCBI		Celera
Cytogenetic Map	4	A1	NCBI
cM Map	4	3.63	NCBI

Rab2a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955444	18,091,640 - 18,169,971 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955444	18,091,640 - 18,169,971 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB2A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	8	51,827,243 - 51,929,882 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	56,931,782 - 57,034,343 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	58,630,403 - 58,698,710 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	58,633,850 - 58,698,710 (+)	Ensembl	panpan1.1		panPan2

RAB2A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	10,953,425 - 11,042,789 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	10,953,371 - 11,041,754 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	11,265,380 - 11,353,510 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	11,046,164 - 11,135,843 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	11,045,930 - 11,136,239 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	11,039,366 - 11,127,487 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	11,176,985 - 11,265,106 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	11,444,643 - 11,532,770 (+)	NCBI		UU_Cfam_GSD_1.0

Rab2a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	62,105,130 - 62,159,229 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936496	12,626,250 - 12,680,365 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936496	12,626,242 - 12,680,334 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB2A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	72,800,623 - 72,882,151 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	72,800,617 - 72,882,183 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	79,257,583 - 79,342,260 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB2A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	56,439,021 - 56,542,059 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	56,438,780 - 56,540,827 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	85,133,880 - 85,238,208 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab2a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	31,357,925 - 31,441,371 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	31,357,926 - 31,441,341 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rab2a
232 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	151
Count of miRNA genes:	128
Interacting mature miRNAs:	137
Transcripts:	ENSRNOT00000008522
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	2138965	32656739	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	3844018	26141981	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	3844018	47869213	Rat
61462	Niddm10	Non-insulin dependent diabetes mellitus QTL 10	3.9	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	5	5112159	47171491	Rat
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat

Markers in Region

AW535887

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	21,703,952 - 21,704,112 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	21,660,642 - 21,660,801	NCBI	Rnor6.0
Rnor_5.0	5	26,413,910 - 26,414,069	UniSTS	Rnor5.0
RGSC_v3.4	5	22,417,319 - 22,417,478	UniSTS	RGSC3.4
Celera	5	20,971,455 - 20,971,614	UniSTS
RH 3.4 Map	5	115.8	UniSTS
Cytogenetic Map	5	q13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J02999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000008522 ⟹ ENSRNOP00000008522

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	21,695,810 - 21,736,933 (+)	Ensembl
Rnor_6.0 Ensembl	5	21,632,926 - 21,695,519 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112446 ⟹ ENSRNOP00000088413

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	21,676,129 - 21,739,899 (+)	Ensembl

RefSeq Acc Id:

NM_031718 ⟹ NP_113906

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	21,676,017 - 21,740,035 (+)	NCBI
Rnor_6.0	5	21,632,909 - 21,695,519 (+)	NCBI
Rnor_5.0	5	26,385,934 - 26,449,989 (+)	NCBI
RGSC_v3.4	5	22,389,585 - 22,452,198 (+)	RGD
Celera	5	20,943,721 - 21,006,339 (+)	RGD

Sequence:

show sequence

ATGGCGTACGCCTATCTCTTCAAGTACATCATCATCGGCGACACAGGTGTTGGTAAATCGTGCT
TATTGCTACAGTTTACAGACAAGAGGTTTCAGCCGGTGCATGACCTCACAATGGGTGTAGAGTT
TGGTGCTCGAATGATAACCATTGATGGGAAACAGATAAAACTCCAGATCTGGGATACAGCAGGG
CAGGAGTCCTTTCGTTCTATCACAAGGTCATATTACAGAGGTGCAGCGGGGGCTTTACTAGTGT
ATGATATTACAAGGAGAGACACGTTCAACCACTTGACAACCTGGTTAGAAGACGCCCGTCAGCA
TTCCAATTCCAACATGGTCATCATGCTTATTGGAAATAAAAGTGACTTAGAATCTAGGAGAGAA
GTGAAAAAGGAAGAAGGTGAAGCTTTTGCACGAGAGCATGGACTTATCTTCATGGAAACTTCTG
CCAAGACTGCTTCTAATGTAGAGGAGGCATTTATTAACACAGCAAAAGAAATTTATGAAAAAAT
CCAAGAAGGGGTCTTTGACATTAATAATGAGGCAAACGGCATCAAAATTGGCCCTCAGCATGCT
GCTACCAATGCATCTCACGGAGGCAACCAAGGAGGGCAGCAGGCAGGGGGAGGCTGCTGCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113906	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42007	(Get FASTA)	NCBI Sequence Viewer
	EDM11646	(Get FASTA)	NCBI Sequence Viewer
	P05712	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113906 ⟸ NM_031718

- UniProtKB:

P05712 (UniProtKB/Swiss-Prot), A0A8I6A522 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTMGVEFGARMITIDGKQIKLQIWDTAG
QESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRRE
VKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHA
ATNASHGGNQGGQQAGGGCC

hide sequence

RefSeq Acc Id:

ENSRNOP00000008522 ⟸ ENSRNOT00000008522

RefSeq Acc Id:

ENSRNOP00000088413 ⟸ ENSRNOT00000112446

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P05712-F1-model_v2	AlphaFold	P05712	1-212	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68323	AgrOrtholog
BioCyc Gene	G2FUF-42055	BioCyc
Ensembl Genes	ENSRNOG00000005963	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000008522.6	UniProtKB/TrEMBL
	ENSRNOP00000088413	ENTREZGENE
	ENSRNOP00000088413.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008522.6	UniProtKB/TrEMBL
	ENSRNOT00000112446	ENTREZGENE
	ENSRNOT00000112446.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:65158	UniProtKB/Swiss-Prot
NCBI Gene	65158	ENTREZGENE
PANTHER	DRAB11-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS-RELATED PROTEIN RAB-2A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rab2a	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
SMART	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC217442
UniProt	A0A8I6A522	ENTREZGENE, UniProtKB/TrEMBL
	F1LP82_RAT	UniProtKB/TrEMBL
	P05712	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-25	Rab2a	RAB2A, member RAS oncogene family	Rab2	RAB2, member RAS oncogene family	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Rab2	RAB2, member RAS oncogene family			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations