Gpbar1 (G protein-coupled bile acid receptor 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gpbar1 (G protein-coupled bile acid receptor 1) Rattus norvegicus

Analyze

Symbol:

Gpbar1

Name:

G protein-coupled bile acid receptor 1

RGD ID:

631400

Description:

Enables G protein-coupled receptor activity. Involved in positive regulation of ERK1 and ERK2 cascade and positive regulation of cholangiocyte proliferation. Predicted to be located in cytoplasm. Predicted to be part of receptor complex. Predicted to be active in plasma membrane. Biomarker of non-alcoholic steatohepatitis and polycystic kidney disease. Orthologous to human GPBAR1 (G protein-coupled bile acid receptor 1); INTERACTS WITH ammonium chloride; beta-naphthoflavone; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein-coupled receptor; G-protein coupled bile acid receptor 1; M-BAR; membrane-type receptor for bile acids; Tgr5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	75,862,151 - 75,863,140 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	75,860,677 - 75,863,168 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	84,307,687 - 84,308,676 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,436,608 - 89,437,597 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	9	87,822,824 - 87,823,813 (+)	NCBI	Rnor_WKY
Rnor_6.0	9	81,555,914 - 81,560,931 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	81,559,605 - 81,560,594 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	81,324,651 - 81,327,608 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	73,605,141 - 73,606,130 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	73,752,122 - 73,753,112 (+)	NCBI
Celera	9	73,438,636 - 73,439,625 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alacrima, achalasia, and impaired intellectual development syndrome (ISO)

autosomal dominant polycystic kidney disease (ISO)

autosomal recessive polycystic kidney disease (ISO)

cerebrotendinous xanthomatosis (ISO)

Constipation (ISO)

Crohn's disease (ISO)

Neurodevelopmental Disorders (ISO)

non-alcoholic steatohepatitis (IEP)

paroxysmal nonkinesigenic dyskinesia 1 (ISO)

polycystic kidney disease (IEP)

polycystic liver disease (ISO)

Severe Combined Immunodeficiency with Microcephaly, Growth Retardation, and Sensitivity to Ionizing Radiation (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

3',5'-cyclic AMP (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

calcium atom (ISO)

calcium(0) (ISO)

chenodeoxycholic acid (ISO)

cholic acid (ISO)

clofibrate (ISO)

colforsin daropate hydrochloride (ISO)

copper atom (EXP)

copper(0) (EXP)

decabromodiphenyl ether (EXP)

deoxycholic acid (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dimethyl sulfoxide (EXP)

furan (EXP)

indole-3-methanol (EXP)

indometacin (ISO)

lithocholic acid (ISO)

methotrexate (ISO)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

oleanolic acid (ISO)

potassium dichromate (ISO)

serotonin (ISO)

silicon dioxide (ISO)

tauroursodeoxycholic acid (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

U-73122 (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell surface bile acid receptor signaling pathway (ISO)

cellular response to bile acid (ISO)

G protein-coupled receptor signaling pathway (IBA)

positive regulation of cholangiocyte proliferation (IMP)

positive regulation of ERK1 and ERK2 cascade (IMP)

regulation of bicellular tight junction assembly (ISO)

Cellular Component

cytoplasm (ISO)

plasma membrane (IBA,ISO)

receptor complex (ISO)

Molecular Function

bile acid receptor activity (ISO)

G protein-coupled bile acid receptor activity (IBA,ISO)

G protein-coupled receptor activity (IBA,IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Farnesoid X receptor agonist INT-767 attenuates liver steatosis and inflammation in rat model of nonalcoholic steatohepatitis.	Hu YB, etal., Drug Des Devel Ther. 2018 Jul 16;12:2213-2221. doi: 10.2147/DDDT.S170518. eCollection 2018.
3.	A G protein-coupled receptor responsive to bile acids.	Kawamata Y, etal., J Biol Chem 2003 Mar 14;278(11):9435-40.
4.	Identification of membrane-type receptor for bile acids (M-BAR).	Maruyama T, etal., Biochem Biophys Res Commun 2002 Nov 15;298(5):714-9.
5.	TGR5 contributes to hepatic cystogenesis in rodents with polycystic liver diseases through cyclic adenosine monophosphate/Gαs signaling.	Masyuk TV, etal., Hepatology. 2017 Oct;66(4):1197-1218. doi: 10.1002/hep.29284. Epub 2017 Aug 26.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:17326144	PMID:18468513	PMID:22046243	PMID:23613625	PMID:23634890	PMID:23849932	PMID:25540233	PMID:27317945	PMID:27470217	PMID:27987324	PMID:28034761
PMID:28946907	PMID:31909787	PMID:32381096	PMID:32443832	PMID:32699194	PMID:33055426	PMID:33427060	PMID:33531049

Genomics

Comparative Map Data

Gpbar1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	75,862,151 - 75,863,140 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	75,860,677 - 75,863,168 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	84,307,687 - 84,308,676 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,436,608 - 89,437,597 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	9	87,822,824 - 87,823,813 (+)	NCBI	Rnor_WKY
Rnor_6.0	9	81,555,914 - 81,560,931 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	81,559,605 - 81,560,594 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	81,324,651 - 81,327,608 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	73,605,141 - 73,606,130 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	73,752,122 - 73,753,112 (+)	NCBI
Celera	9	73,438,636 - 73,439,625 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

GPBAR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	218,259,496 - 218,263,861 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	218,259,496 - 218,263,861 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	219,124,219 - 219,128,584 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	218,833,983 - 218,836,826 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	218,951,257 - 218,954,087	NCBI
Celera	2	212,892,317 - 212,895,161 (+)	NCBI		Celera
Cytogenetic Map	2	q35	NCBI
HuRef	2	210,978,835 - 210,981,679 (+)	NCBI		HuRef
CHM1_1	2	219,132,227 - 219,135,071 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	218,745,197 - 218,749,562 (+)	NCBI		T2T-CHM13v2.0

Gpbar1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	74,317,759 - 74,318,748 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	74,317,709 - 74,318,783 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	74,278,600 - 74,279,589 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	74,278,550 - 74,279,624 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	74,325,174 - 74,326,163 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	74,211,807 - 74,212,796 (+)	NCBI		MGSCv36	mm8
Celera	1	74,839,953 - 74,840,942 (+)	NCBI		Celera
Cytogenetic Map	1	C3	NCBI
cM Map	1	38.53	NCBI

Gpbar1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	15,109,711 - 15,112,438 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	15,109,711 - 15,112,438 (-)	NCBI	ChiLan1.0	ChiLan1.0

GPBAR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2B	224,116,896 - 224,121,263 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	224,120,127 - 224,121,119 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2B	105,520,364 - 105,523,229 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GPBAR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	24,937,955 - 24,943,546 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	24,940,325 - 24,943,421 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	25,759,271 - 25,763,567 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	24,955,171 - 24,959,466 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	24,956,387 - 24,959,328 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	24,860,410 - 24,865,048 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	24,794,673 - 24,799,052 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	24,814,333 - 24,818,678 (+)	NCBI		UU_Cfam_GSD_1.0

Gpbar1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	174,444,119 - 174,451,783 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	793,426 - 794,421 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936569	792,393 - 794,764 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPBAR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	120,336,488 - 120,339,505 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	120,336,196 - 120,339,506 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	133,440,341 - 133,443,017 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPBAR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	104,141,177 - 104,145,557 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	104,144,421 - 104,145,413 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	95,256,259 - 95,260,625 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpbar1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624823	6,766,816 - 6,769,473 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624823	6,766,816 - 6,769,490 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gpbar1
1 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	56627713	78595166	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	9	56627713	78595166	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56627713	78595166	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat

Markers in Region

AI548141

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	75,862,878 - 75,863,061 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	81,560,333 - 81,560,515	NCBI	Rnor6.0
Rnor_5.0	9	81,326,880 - 81,327,062	UniSTS	Rnor5.0
RGSC_v3.4	9	73,605,869 - 73,606,051	UniSTS	RGSC3.4
Celera	9	73,439,364 - 73,439,546	UniSTS
RH 3.4 Map	9	759.7	UniSTS
Cytogenetic Map	9	q33	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low			18	8	15	8			2	3	10	10
Below cutoff	3	13	32	26	3	26	7	7	7	18	21	1	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_177936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006245235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB086172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB089310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JX534229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000089698 ⟹ ENSRNOP00000075574

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	75,860,677 - 75,863,168 (+)	Ensembl
Rnor_6.0 Ensembl	9	81,559,605 - 81,560,594 (+)	Ensembl

RefSeq Acc Id:

NM_177936 ⟹ NP_808797

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	75,862,151 - 75,863,140 (+)	NCBI
Rnor_6.0	9	81,559,605 - 81,560,594 (+)	NCBI
Rnor_5.0	9	81,324,651 - 81,327,608 (+)	NCBI
RGSC_v3.4	9	73,605,141 - 73,606,130 (+)	RGD
Celera	9	73,438,636 - 73,439,625 (+)	RGD

Sequence:

show sequence

ATGATGTCACACAACACCACTGAGCTGTCAGCCATTCCCAGAGGGGTTCAGGAGCTTTCCCTGG
TCCTGGCAAGCCTCATCGTCATCGCCAACCTGCTCCTGGCCCTAGGCATTGTCCTGGACCGCCA
CTTACGCAGCCCACCTGCTGGCTGCTTCTTTCTAAGCCTACTACTAGCTGGGCTACTCACAGGG
TTGGCACTGCCCACGCTGCCTGGGCTATGGAATAGGAGCCATCAGGGGTACTGGTCCTGCCTCC
TTCTCCACTTGGCCCCCAACTTTTGTTTCCTCTCCCTGCTTGCCAATCTGCTGCTGGTGCATGG
GGAACGCTACATGGCAGTGTTGCAGCCACTCCGGCCCCATGGGAGTGTGCGGCTAGCCCTGTTC
CTCACCTGGATCAGCTCCCTGCTCTTTGCCAGCCTGCCTGCTCTGGGCTGGAACCACTGGAGTC
CTGGTGCCAACTGCAGCTCCCAGGCTATCTTCCCAGCCCCCTACCTTTACCTCGAAGTCTATGG
GCTCCTGCTGCCCGCTGTGGGGGCCACTGCCCTTCTCTCTGTCCGAGTGTTGGCCACTGCCCAC
CACCAGCTGCGGGAGATCCGCAGACTGGAGCGGGCGGTGTGCCGTGATGCACCCTCAACCCTAG
CGAGGGCTCTCACCTGGAGGCAGGCTAGGGCACAGGCAGGAGCCACACTGCTCTTTTTGCTGTG
TTGGGGGCCCTATGTGGCCACATTGCTCCTGTCAGTCTTGGCCTATGAGCGGCGGCCACCACTA
GGGCCTGTAACTCTGTTATCTCTCATCTCATTGGGCAGTGCCAGTGCTGCAGTTGTGCCTGTGG
CCATGGGTCTGGGTGATCAGCGCTACACGGCCCCCTGGAGGACAGCTGCCCAAAGGTGGCTACA
AGTGCTTCGAGGAAGACCCAAGAGGGCCAATCCAGGCCCCAGCACTGCCTACCACTCCAGTAGC
CAATGCAGCACTGACTTGGACTTGAATTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_808797	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AGJ50516	(Get FASTA)	NCBI Sequence Viewer
	BAC55238	(Get FASTA)	NCBI Sequence Viewer
	BAC65345	(Get FASTA)	NCBI Sequence Viewer
	EDL75340	(Get FASTA)	NCBI Sequence Viewer
	Q80T02	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_808797 ⟸ NM_177936

- UniProtKB:

Q80T02 (UniProtKB/Swiss-Prot), U5JAP5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMSHNTTELSAIPRGVQELSLVLASLIVIANLLLALGIVLDRHLRSPPAGCFFLSLLLAGLLTG
LALPTLPGLWNRSHQGYWSCLLLHLAPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALF
LTWISSLLFASLPALGWNHWSPGANCSSQAIFPAPYLYLEVYGLLLPAVGATALLSVRVLATAH
HQLREIRRLERAVCRDAPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPL
GPVTLLSLISLGSASAAVVPVAMGLGDQRYTAPWRTAAQRWLQVLRGRPKRANPGPSTAYHSSS
QCSTDLDLN

hide sequence

RefSeq Acc Id:

ENSRNOP00000075574 ⟸ ENSRNOT00000089698

Protein Domains

G_PROTEIN_RECEP_F1_2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q80T02-F1-model_v2	AlphaFold	Q80T02	1-329	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631400	AgrOrtholog
BioCyc Gene	G2FUF-27144	BioCyc
Ensembl Genes	ENSRNOG00000058260	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000075574	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000089698	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:338443	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	338443	ENTREZGENE
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gpbar1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	GPBAR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	U5JAP5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-11	Gpbar1	G protein-coupled bile acid receptor 1	Tgr5	G protein-coupled receptor	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_process	may be involved in the suppression of macrophage functions by bile acids	634463
gene_regulation	receptor internalization is induced by bile acids	634463

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD